Protein Information

General Information
MoonProt ID430
First appeared in release3.0
Name(s)Transcriptional coactivator YAP1, Yes-associated protein 1, Yes-associated protein YAP65 homolog, Protein yorkie homolog
UniProt IDP46937
GO termsGO:0005634 nucleus GO:1904036 negative regulation of epithelial cell apoptotic process GO:0010629 negative regulation of gene expression GO:0010628 positive regulation of gene expression GO:0050679 positive regulation of epithelial cell proliferation GO:0035329 hippo signaling GO:0003713 transcription coactivator activity GO:0003714 transcription corepressor activity GO:0045944 positive regulation of transcription by RNA polymerase II GO:0032570 response to progesterone GO:0033148 positive regulation of intracellular estrogen receptor signaling pathway GO:0045747 positive regulation of Notch signaling pathway GO:0070102 interleukin-6-mediated signaling pathway GO:0060242 contact inhibition GO:0050847 progesterone receptor signaling pathway GO:0060576 intestinal epithelial cell development GO:0008283 cell population proliferation GO:0005737 cytoplasm GO:0003714 transcription corepressor activity GO:0003713 transcription coactivator activity GO:0035329 hippo signaling GO:0005515 protein binding GO:0072091 regulation of stem cell proliferation GO:0050767 regulation of neurogenesis GO:0005654 nucleoplasm GO:0006367 transcription initiation from RNA polymerase II promoter GO:1902036 regulation of hematopoietic stem cell differentiation GO:0005515 protein binding GO:2000737 negative regulation of stem cell differentiation GO:0072307 regulation of metanephric nephron tubule epithelial cell differentiation GO:0070102 interleukin-6-mediated signaling pathway GO:0061026 cardiac muscle tissue regeneration GO:0060449 bud elongation involved in lung branching GO:0060045 positive regulation of cardiac muscle cell proliferation GO:0045747 positive regulation of Notch signaling pathway GO:0042127 regulation of cell population proliferation GO:0042060 wound healing GO:0035329 hippo signaling GO:0030903 notochord development GO:0008284 positive regulation of cell population proliferation GO:0008022 protein C-terminus binding GO:0005829 cytosol GO:0003682 chromatin binding GO:0001570 vasculogenesis GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000902 cell morphogenesis GO:2001237 negative regulation of extrinsic apoptotic signaling pathway GO:1902459 positive regulation of stem cell population maintenance GO:0090263 positive regulation of canonical Wnt signaling pathway GO:0072091 regulation of stem cell proliferation GO:0071300 cellular response to retinoic acid GO:0070064 proline-rich region binding GO:0060828 regulation of canonical Wnt signaling pathway GO:0060576 intestinal epithelial cell development GO:0060487 lung epithelial cell differentiation GO:0048368 lateral mesoderm development GO:0048339 paraxial mesoderm development GO:0046622 positive regulation of organ growth GO:0045944 positive regulation of transcription by RNA polymerase II GO:0035019 somatic stem cell population maintenance GO:0030857 negative regulation of epithelial cell differentiation GO:0030216 keratinocyte differentiation GO:0016020 membrane GO:0010837 regulation of keratinocyte proliferation GO:0010468 regulation of gene expression GO:0008134 transcription factor binding GO:0005737 cytoplasm GO:0005667 transcription regulator complex GO:0003713 transcription coactivator activity GO:0003143 embryonic heart tube morphogenesis GO:0003015 heart process GO:0001894 tissue homeostasis GO:1903507 negative regulation of nucleic acid-templated transcription GO:0065003 protein-containing complex assembly GO:0071149 TEAD-2-YAP complex GO:0005515 protein binding GO:0140297 DNA-binding transcription factor binding GO:0045893 positive regulation of transcription, DNA-templated GO:0065003 protein-containing complex assembly GO:0071148 TEAD-1-YAP complex GO:0045944 positive regulation of transcription by RNA polymerase II GO:0003713 transcription coactivator activity GO:0000976 transcription regulatory region sequence-specific DNA binding GO:0071480 cellular response to gamma radiation GO:0006974 cellular response to DNA damage stimulus
Organisms for which functions have been demonstratedHomo sapiens (human, a mammal)
Sequence length504 amino acids
FASTA sequence>sp|P46937|YAP1_HUMAN Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2 MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Structure Information
PDB ID3KYS_B
Quaternary structureNA
SCOPNA
CATHNA
TM Helix Predictionno TM helices
DisProt Annotation14.1%, 101-171
Predicted Disorder RegionsPredicted disorder at N terminus (aa 1-60), middle region (aa 80-139, 143-168, 173-177, 201-238, 261-318, 320-446, 455-470), and C terminus (aa 502-504)
Connections to Disease
OMIM ID
Function 1
Function descriptionTranscriptional regulator; the downstream regulatory target in the Hippo signaling pathway that plays a role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis
References for function21364637
E.C. numberNA
Location of functional site(s)NA
Cellular location of functionnucleus
CommentsNA
Function 2
Function descriptionBinds RUNX proteins, binds PATJ, in cytokinesis
References for function26933062
E.C. numberNA
Location of functional site(s)NA
Cellular location of functionMidbody dark zone
CommentsYAP is phosphorylated during mitosis and this modification is essential for its function in cytokinesis, defective cytokinesis (abscission) occurs with loss of function