| General Information |
| MoonProt ID | 430 |
| First appeared in release | 3.0 |
| Name(s) | Transcriptional coactivator YAP1, Yes-associated protein 1, Yes-associated protein YAP65 homolog, Protein yorkie homolog |
| UniProt ID | P46937 |
| GO terms | GO:0005634 nucleus
GO:1904036 negative regulation of epithelial cell apoptotic process
GO:0010629 negative regulation of gene expression
GO:0010628 positive regulation of gene expression
GO:0050679 positive regulation of epithelial cell proliferation
GO:0035329 hippo signaling
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0032570 response to progesterone
GO:0033148 positive regulation of intracellular estrogen receptor signaling pathway
GO:0045747 positive regulation of Notch signaling pathway
GO:0070102 interleukin-6-mediated signaling pathway
GO:0060242 contact inhibition
GO:0050847 progesterone receptor signaling pathway
GO:0060576 intestinal epithelial cell development
GO:0008283 cell population proliferation
GO:0005737 cytoplasm
GO:0003714 transcription corepressor activity
GO:0003713 transcription coactivator activity
GO:0035329 hippo signaling
GO:0005515 protein binding
GO:0072091 regulation of stem cell proliferation
GO:0050767 regulation of neurogenesis
GO:0005654 nucleoplasm
GO:0006367 transcription initiation from RNA polymerase II promoter
GO:1902036 regulation of hematopoietic stem cell differentiation
GO:0005515 protein binding
GO:2000737 negative regulation of stem cell differentiation
GO:0072307 regulation of metanephric nephron tubule epithelial cell differentiation
GO:0070102 interleukin-6-mediated signaling pathway
GO:0061026 cardiac muscle tissue regeneration
GO:0060449 bud elongation involved in lung branching
GO:0060045 positive regulation of cardiac muscle cell proliferation
GO:0045747 positive regulation of Notch signaling pathway
GO:0042127 regulation of cell population proliferation
GO:0042060 wound healing
GO:0035329 hippo signaling
GO:0030903 notochord development
GO:0008284 positive regulation of cell population proliferation
GO:0008022 protein C-terminus binding
GO:0005829 cytosol
GO:0003682 chromatin binding
GO:0001570 vasculogenesis
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000902 cell morphogenesis
GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
GO:1902459 positive regulation of stem cell population maintenance
GO:0090263 positive regulation of canonical Wnt signaling pathway
GO:0072091 regulation of stem cell proliferation
GO:0071300 cellular response to retinoic acid
GO:0070064 proline-rich region binding
GO:0060828 regulation of canonical Wnt signaling pathway
GO:0060576 intestinal epithelial cell development
GO:0060487 lung epithelial cell differentiation
GO:0048368 lateral mesoderm development
GO:0048339 paraxial mesoderm development
GO:0046622 positive regulation of organ growth
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0035019 somatic stem cell population maintenance
GO:0030857 negative regulation of epithelial cell differentiation
GO:0030216 keratinocyte differentiation
GO:0016020 membrane
GO:0010837 regulation of keratinocyte proliferation
GO:0010468 regulation of gene expression
GO:0008134 transcription factor binding
GO:0005737 cytoplasm
GO:0005667 transcription regulator complex
GO:0003713 transcription coactivator activity
GO:0003143 embryonic heart tube morphogenesis
GO:0003015 heart process
GO:0001894 tissue homeostasis
GO:1903507 negative regulation of nucleic acid-templated transcription
GO:0065003 protein-containing complex assembly
GO:0071149 TEAD-2-YAP complex
GO:0005515 protein binding
GO:0140297 DNA-binding transcription factor binding
GO:0045893 positive regulation of transcription, DNA-templated
GO:0065003 protein-containing complex assembly
GO:0071148 TEAD-1-YAP complex
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0003713 transcription coactivator activity
GO:0000976 transcription regulatory region sequence-specific DNA binding
GO:0071480 cellular response to gamma radiation
GO:0006974 cellular response to DNA damage stimulus |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 504 amino acids |
| FASTA sequence | >sp|P46937|YAP1_HUMAN Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL |
| Structure Information |
| PDB ID | 3KYS_B |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | 14.1%, 101-171 |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-60), middle region (aa 80-139, 143-168, 173-177, 201-238, 261-318, 320-446, 455-470), and C terminus (aa 502-504) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Transcriptional regulator; the downstream regulatory target in the Hippo signaling pathway that plays a role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis |
| References for function | 21364637 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | nucleus |
| Comments | NA |
| Function 2 |
| Function description | Binds RUNX proteins, binds PATJ, in cytokinesis |
| References for function | 26933062 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | Midbody dark zone |
| Comments | YAP is phosphorylated during mitosis and this modification is essential for its function in cytokinesis, defective cytokinesis (abscission) occurs with loss of function |