| General Information |
| MoonProt ID | 431 |
| First appeared in release | 3.0 |
| Name(s) | Y-box-binding protein 1 (YB-1); CCAAT-binding transcription factor I subunit A (CBF-A); DNA-binding protein B (DBPB); Enhancer factor I subunit A (EFI-A); Nuclease-sensitive element-binding protein 1; gamma-box transcription factor; gene: YBX1 or NSEP1 |
| UniProt ID | P67809 |
| GO terms | GO:0003723 RNA binding
GO:0048598 embryonic morphogenesis
GO:0017148 negative regulation of translation
GO:0008544 epidermis development
GO:0051031 tRNA transport
GO:2000773 negative regulation of cellular senescence
GO:0071204 histone pre-mRNA 3'end processing complex
GO:0050658 RNA transport
GO:0003676 nucleic acid binding
GO:0005576 extracellular region
GO:0051781 positive regulation of cell division
GO:0006397 mRNA processing
GO:0005634 nucleus
GO:0008380 RNA splicing
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
GO:0005737 cytoplasm
GO:1903608 protein localization to cytoplasmic stress granule
GO:0000398 mRNA splicing, via spliceosome
GO:0005576 extracellular region
GO:0005654 nucleoplasm
GO:0007219 Notch signaling pathway
GO:0005515 protein binding
GO:0005576 extracellular region
GO:0043231 intracellular membrane-bounded organelle
GO:0031965 nuclear membrane
GO:0005829 cytosol
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0070937 CRD-mediated mRNA stability complex
GO:1990904 ribonucleoprotein complex
GO:0051020 GTPase binding
GO:0070062 extracellular exosome
GO:0070934 CRD-mediated mRNA stabilization |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 324 amino acids |
| FASTA sequence | >sp|P67809|YBOX1_HUMAN Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3
MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_431_uniID_P67809 is 324 residues long, with 324 residues (100.00%) predicted as disordered.The protein has 0 short (< 30 residues) disorder segments and 1 long (>= 30 residues) disorder segment.
Segment 1 - Long (>= 30 residues) disordered segment Segment is located between positions 1 and 324 in the sequence. The segment is 324 residues long (100.00 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | DNA and RNA binding,has roles in transcription, translation, and splicing, |
| References for function | 8188694 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | centrosomes; nucleus |
| Comments | NA |
| Function 2 |
| Function description | binds gamma-tubulin and PCNT |
| References for function | NA |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | centrosomes; nucleus |
| Comments | In YB-1-depleted cells, centrosomes are structurally abnormal and have reduced MT nucleation
ability |