| General Information |
| MoonProt ID | 435 |
| First appeared in release | 3.0 |
| Name(s) | ADP/ATP translocase 1ADP,ATP carrier protein 1
ADP,ATP carrier protein, heart/skeletal muscle isoform T1
Adenine nucleotide translocator 1
Short name: ANT 1
Gene: SLC25A4 |
| UniProt ID | P12235 |
| GO terms | GO:0000002 mitochondrial genome maintenance
GO:0005347 ATP transmembrane transporter activity
GO:0005471 ATP:ADP antiporter activity
GO:0005515 protein binding
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005887 integral component of plasma membrane
GO:0006091 generation of precursor metabolites and energy
GO:0008637 apoptotic mitochondrial changes
GO:0015207 adenine transmembrane transporter activity
GO:0015853 adenine transport
GO:0015866 ADP transport
GO:0016020 membrane
GO:0016021 integral component of membrane
GO:0016032 viral process
GO:0032592 integral component of mitochondrial membrane
GO:0050796 regulation of insulin secretion
GO:0055085 transmembrane transport
GO:0060546 negative regulation of necroptotic process
GO:0140021 mitochondrial ADP transmembrane transport
GO:1990544 mitochondrial ATP transmembrane transport |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 298 amino acids |
| FASTA sequence | >sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens OX=9606 GN=SLC25A4 PE=1 SV=4
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV |
| Structure Information |
| PDB ID | 1OKC_A |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | 3 (112-134, 172-194, 209-231) |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_435_uniID_P12235 is 298 residues long, with 0 residues (0.00%) predicted as disordered.The protein has 0 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments. |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | adenine nucleotide translocator, ADP/ATP exchanger, mitochondria |
| References for function | Hoshino A, Wang WJ, Wada S, McDermott-Roe C, Evans CS, Gosis B, Morley MP, Rathi KS, Li J, Li K, Yang S. The ADP/ATP translocase drives mitophagy independent of nucleotide exchange. Nature. 2019 Nov;575(7782):375-9. PMID: 31618756
|
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | NA |
| Comments | NA |
| Function 2 |
| Function description | Interacts with TIM44 protein and affects the activity of the TIM23 complex |
| References for function | Hoshino A, Wang WJ, Wada S, McDermott-Roe C, Evans CS, Gosis B, Morley MP, Rathi KS, Li J, Li K, Yang S. The ADP/ATP translocase drives mitophagy independent of nucleotide exchange. Nature. 2019 Nov;575(7782):375-9. PMID: 31618756
|
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | NA |
| Comments | NA |