| General Information |
| MoonProt ID | 438 |
| First appeared in release | 3.0 |
| Name(s) | Fructose-bisphosphate aldolase, FBA1 |
| UniProt ID | Q9URB4 |
| GO terms | GO:0044416 induction by symbiont of host defense response
GO:0030446 hyphal cell wall
GO:0009277 fungal-type cell wall
GO:0051701 interaction with host
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0005515 protein binding |
| Organisms for which functions have been demonstrated | Candida tropicalis (yeast, a fungi) |
| Sequence length | 359 amino acids |
| FASTA sequence | >sp|Q9URB4|ALF_CANAL Fructose-bisphosphate aldolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FBA1 PE=1 SV=2
MAPPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQ
TSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFD
GMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGG
EEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEI
LGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGI
RDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_438_uniID_Q9URB4 is 359 residues long, with 0 residues (0.00%) predicted as disordered.The protein has 0 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments. |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Glycolytic enzyme; fructose bisphosphate aldolase |
| References for function | Kozik, A.; Karkowska-Kuleta, J.; Zajac, D.; Bochenska, O.; Kedracka-Krok, S.; Jankowska, U.; Rapala-Kozik, M. Fibronectin-, vitronectin- and laminin-binding proteins at the cell walls of Candida parapsilosis and Candida tropicalis pathogenic yeasts. BMC Microbiol. 2015, 15, 197. |
| E.C. number | 4.1.2.13 |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm |
| Comments | NA |
| Function 2 |
| Function description | binds fibronectin, vitronectin, and laminin |
| References for function | Kozik, A., Karkowska-Kuleta, J., Zajac, D., Bochenska, O., Kedracka-Krok, S., Jankowska, U., Rapala-Kozik, M. Fibronectin-, vitronectin- and laminin-binding proteins at the cell walls of Candida parapsilosis and Candida tropicalis pathogenic yeasts. BMC Microbiol. 2015, 15, 197. |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | NA |
| Comments | NA |