| General Information |
| MoonProt ID | 439 |
| First appeared in release | 3.0 |
| Name(s) | Enolase 1, ENO1 |
| UniProt ID | C5M5Z6 |
| GO terms | GO:0019509 L-methionine salvage from methylthioadenosine
GO:0000287 magnesium ion binding
GO:0043874 acireductone synthase activity
GO:0008652 cellular amino acid biosynthetic process
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0009086 methionine biosynthetic process |
| Organisms for which functions have been demonstrated | Candida tropicalis (yeast, a fungi) |
| Sequence length | 240 amino acids |
| FASTA sequence | >sp|C5M5Z6|ENOPH_CANTT Enolase-phosphatase E1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) OX=294747 GN=UTR4 PE=3 SV=1
MTIDTVILDIEGTVCPITFVKDTLFPYFLTKLPSILSSIEFPLSTSSSTNDDPIIQILKQLPESITISNESVFSYLKNLVDQDIKDPILKSLQGYIWEKGYEIGDLKAPIYKDSIKFIENFNKKIYIYSSGSIKAQILLFGHAEKDQESINLNPFLKGYFDITTAGFKNKSESYIKILNEINKSNDPSSVLFLSDNVNEVKSAIESGMNSYIVIRPGNAPLSDDDKSTYKTIHSLDELTL |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_439_uniID_C5M5Z6 is 240 residues long, with 0 residues (0.00%) predicted as disordered.The protein has 0 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments. |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Enolase 1 |
| References for function | Kozik, A.; Karkowska-Kuleta, J.; Zajac, D.; Bochenska, O.; Kedracka-Krok, S.; Jankowska, U.; Rapala-Kozik, M. Fibronectin-, vitronectin- and laminin-binding proteins at the cell walls of Candida parapsilosis and Candida tropicalis pathogenic yeasts. BMC Microbiol. 2015, 15, 197. |
| E.C. number | 4.2.1.11 |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm |
| Comments | NA |
| Function 2 |
| Function description | ECM protein binding (fibronectin, vitronectin and laminin) |
| References for function | Kozik, A.; Karkowska-Kuleta, J.; Zajac, D.; Bochenska, O.; Kedracka-Krok, S.; Jankowska, U.; Rapala-Kozik, M. Fibronectin-, vitronectin- and laminin-binding proteins at the cell walls of Candida parapsilosis and Candida tropicalis pathogenic yeasts. BMC Microbiol. 2015, 15, 197. |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | cell surface |
| Comments | NA |