| General Information |
| MoonProt ID | 440 |
| First appeared in release | 3.0 |
| Name(s) | Wilms tumor protein, Gene = WT1 |
| UniProt ID | P19544 (WT1_HUMAN) |
| GO terms | GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000790 nuclear chromatin
GO:0000976 transcription regulatory region sequence-specific DNA binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001570 vasculogenesis
GO:0001657 ureteric bud development
GO:0001658 branching involved in ureteric bud morphogenesis
GO:0001822 kidney development
GO:0003156 regulation of animal organ formation
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0006355 regulation of transcription, DNA-templated
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007281 germ cell development
GO:0007356 thorax and anterior abdomen determination
GO:0007507 heart development
GO:0007530 sex determination
GO:0008270 zinc ion binding
GO:0008285 negative regulation of cell population proliferation
GO:0008380 RNA splicing
GO:0008406 gonad development
GO:0008584 male gonad development
GO:0009888 tissue development
GO:0010385 double-stranded methylated DNA binding
GO:0010628 positive regulation of gene expression
GO:0016607 nuclear speck
GO:0017148 negative regulation of translation
GO:0030308 negative regulation of cell growth
GO:0030325 adrenal gland development
GO:0030539 male genitalia development
GO:0030855 epithelial cell differentiation
GO:0032835 glomerulus development
GO:0032836 glomerular basement membrane development
GO:0035802 adrenal cortex formation
GO:0043010 camera-type eye development
GO:0043065 positive regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043565 sequence-specific DNA binding
GO:0044729 hemi-methylated DNA-binding
GO:0045892 negative regulation of transcription, DNA-templated
GO:0045893 positive regulation of transcription, DNA-templated
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046872 metal ion binding
GO:0060231 mesenchymal to epithelial transition
GO:0060421 positive regulation of heart growth
GO:0060539 diaphragm development
GO:0060923 cardiac muscle cell fate commitment
GO:0061032 visceral serous pericardium development
GO:0070742 C2H2 zinc finger domain binding
GO:0071320 cellular response to cAMP
GO:0071371 cellular response to gonadotropin stimulus
GO:0072075 metanephric mesenchyme development
GO:0072112 glomerular visceral epithelial cell differentiation
GO:0072166 posterior mesonephric tubule development
GO:0072207 metanephric epithelium development
GO:0072284 metanephric S-shaped body morphogenesis
GO:0072302 negative regulation of metanephric glomerular mesangial cell proliferation
GO:1902895 positive regulation of pri-miRNA transcription by RNA polymerase II
GO:1905643 positive regulation of DNA methylation
GO:2000020 positive regulation of male gonad development
GO:2000195 negative regulation of female gonad development
GO:2001076 positive regulation of metanephric ureteric bud development
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000790 nuclear chromatin
GO:0000976 transcription regulatory region sequence-specific DNA binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001570 vasculogenesis
GO:0001657 ureteric bud development
GO:0001658 branching involved in ureteric bud morphogenesis
GO:0001822 kidney development
GO:0003156 regulation of animal organ formation
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0006355 regulation of transcription, DNA-templated
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007281 germ cell development
GO:0007356 thorax and anterior abdomen determination
GO:0007507 heart development
GO:0007530 sex determination
GO:0008270 zinc ion binding
GO:0008285 negative regulation of cell population proliferation
GO:0008380 RNA splicing
GO:0008406 gonad development
GO:0008584 male gonad development
GO:0009888 tissue development
GO:0010385 double-stranded methylated DNA binding
GO:0010628 positive regulation of gene expression
GO:0016607 nuclear speck
GO:0017148 negative regulation of translation
GO:0030308 negative regulation of cell growth
GO:0030325 adrenal gland development
GO:0030539 male genitalia development
GO:0030855 epithelial cell differentiation
GO:0032835 glomerulus development
GO:0032836 glomerular basement membrane development
GO:0035802 adrenal cortex formation
GO:0043010 camera-type eye development
GO:0043065 positive regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043565 sequence-specific DNA binding
GO:0044729 hemi-methylated DNA-binding
GO:0045892 negative regulation of transcription, DNA-templated
GO:0045893 positive regulation of transcription, DNA-templated
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046872 metal ion binding
GO:0060231 mesenchymal to epithelial transition
GO:0060421 positive regulation of heart growth
GO:0060539 diaphragm development
GO:0060923 cardiac muscle cell fate commitment
GO:0061032 visceral serous pericardium development
GO:0070742 C2H2 zinc finger domain binding
GO:0071320 cellular response to cAMP
GO:0071371 cellular response to gonadotropin stimulus
GO:0072075 metanephric mesenchyme development
GO:0072112 glomerular visceral epithelial cell differentiation
GO:0072166 posterior mesonephric tubule development
GO:0072207 metanephric epithelium development
GO:0072284 metanephric S-shaped body morphogenesis
GO:0072302 negative regulation of metanephric glomerular mesangial cell proliferation
GO:1902895 positive regulation of pri-miRNA transcription by RNA polymerase II
GO:1905643 positive regulation of DNA methylation
GO:2000020 positive regulation of male gonad development
GO:2000195 negative regulation of female gonad development
GO:2001076 positive regulation of metanephric ureteric bud development
|
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 449 anino acids |
| FASTA sequence | >sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAP
PPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQA
SSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHED
PMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ
MNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV
RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDC
ERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS
CQKKFARSDELVRHHNMHQRNMTKLQLAL |
| Structure Information |
| PDB ID | 6BLW (only zinc finger domain) |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | 3.30.160.60 |
| TM Helix Prediction | no TM helics |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-6), middle region (aa 48-85, 109-127, 149-200, 259-273, 369-377, 397-406), and C terminus (aa 442-449) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Transcription factor, binds DNA |
| References for function | Hamilton TB, Barilla KC, Romaniuk PJ. High affinity binding sites for the Wilms' tumour suppressor protein WT1. Nucleic Acids Res. 1995;23(2):277-284. doi:10.1093/nar/23.2.277 PMID: 7862533 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | nucleus |
| Comments | NA |
| Function 2 |
| Function description | binds MAD2, without it see Accelerated metaphase-to-anaphase transition; defective chromosome segregation |
| References for function | Shandilya J, Toska E, Richard DJ, Medler KF, Roberts SG. WT1 interacts with MAD2 and regulates mitotic checkpoint function. Nat Commun. 2014;5:4903. Published 2014 Sep 18. doi:10.1038/ncomms5903; Shandilya J, Roberts SG. A role of WT1 in cell division and genomic stability. Cell Cycle. 2015;14(9):1358-1364. doi:10.1080/15384101.2015.1021525 PMID: 25789599 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | kinetochore |
| Comments | NA |