| General Information |
| MoonProt ID | 441 |
| First appeared in release | 3.0 |
| Name(s) | IIH helicase subunit XPB |
| UniProt ID | P19447 (ERCC3_HUMAN) |
| GO terms | GO:0000112 nucleotide-excision repair factor 3 complex
GO:0000166 nucleotide binding
GO:0000439 transcription factor TFIIH core complex
GO:0000717 nucleotide-excision repair, DNA duplex unwinding
GO:0001666 response to hypoxia
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003684 damaged DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005675 transcription factor TFIIH holo complex
GO:0006265 DNA topological change
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006289 nucleotide-excision repair
GO:0006293 nucleotide-excision repair, preincision complex stabilization
GO:0006294 nucleotide-excision repair, preincision complex assembly
GO:0006295 nucleotide-excision repair, DNA incision, 3'-to lesion
GO:0006296 nucleotide-excision repair, DNA incision, 5'-to lesion
GO:0006361 transcription initiation from RNA polymerase I promoter
GO:0006362 transcription elongation from RNA polymerase I promoter
GO:0006363 termination of RNA polymerase I transcription
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation from RNA polymerase II promoter
GO:0006368 transcription elongation from RNA polymerase II promoter
GO:0006370 7-methylguanosine mRNA capping
GO:0006915 apoptotic process
GO:0006974 cellular response to DNA damage stimulus
GO:0006979 response to oxidative stress
GO:0008022 protein C-terminus binding
GO:0008104 protein localization
GO:0008134 transcription factor binding
GO:0009411 response to UV
GO:0009650 UV protection
GO:0016032 viral process
GO:0016787 hydrolase activity
GO:0016887 ATPase activity
GO:0033683 nucleotide-excision repair, DNA incision
GO:0035315 hair cell differentiation
GO:0043065 positive regulation of apoptotic process
GO:0043138 3'-5' DNA helicase activity
GO:0047485 protein N-terminus binding
GO:0048568 embryonic organ development
GO:0070911 global genome nucleotide-excision repair
GO:0097550 transcription preinitiation complex
GO:1901990 regulation of mitotic cell cycle phase transition
GO:1990841 promoter-specific chromatin binding
|
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 782 amino acids |
| FASTA sequence | >sp|P19447|ERCC3_HUMAN General transcription and DNA repair factor IIH helicase subunit XPB OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD
YRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA
YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESC
HPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG
KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND
SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKR
CLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRS
WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL
NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNK
FRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP
KINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFY
SLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT
DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRF
RK |
| Structure Information |
| PDB ID | 5IVW |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_441_uniID_P19447 is 782 residues long, with 198 residues (25.32%) predicted as disordered.The protein has 0 short (< 30 residues) disorder segments and 3 long (>= 30 residues) disorder segments.
Segment 1 - Long (>= 30 residues) disordered segment Segment is located between positions 1 and 68 in the sequence. The segment is 68 residues long (8.70 % of the total sequence length).
Segment 2 - Long (>= 30 residues) disordered segment Segment is located between positions 207 and 272 in the sequence. The segment is 66 residues long (8.44 % of the total sequence length).
Segment 3 - Long (>= 30 residues) disordered segment Segment is located between positions 719 and 782 in the sequence. The segment is 64 residues long (8.18 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ATP-dependent 3'-5' DNA helicase, component of the general transcription and DNA repair factor IIH (TFIIH) core complex |
| References for function | 30894545 |
| E.C. number | 3.6.4.12 |
| Location of functional site(s) | NA |
| Cellular location of function | nucleus |
| Comments | NA |
| Function 2 |
| Function description | binds gamma-tubulin |
| References for function | 20208140 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | centromeres and spindle poles |
| Comments | NA |