| General Information |
| MoonProt ID | 444 |
| First appeared in release | 3.0 |
| Name(s) | 58 kDa microspherule protein Cell cycle-regulated factor p78 INO80 complex subunit J MCRS2 |
| UniProt ID | Q96EZ8 (MCRS1_HUMAN) |
| GO terms | GO:0000123 histone acetyltransferase complex
GO:0002151 G-quadruplex RNA binding
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005844 polysome
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006325 chromatin organization
GO:0006464 cellular protein modification process
GO:0006974 cellular response to DNA damage stimulus
GO:0008266 poly(U) RNA binding
GO:0010521 telomerase inhibitor activity
GO:0016032 viral process
GO:0016579 protein deubiquitination
GO:0030425 dendrite
GO:0031011 Ino80 complex
GO:0034046 poly(G) binding
GO:0043204 perikaryon
GO:0043981 histone H4-K5 acetylation
GO:0043982 histone H4-K8 acetylation
GO:0043984 histone H4-K16 acetylation
GO:0043995 histone acetyltransferase activity (H4-K5 specific)
GO:0043996 histone acetyltransferase activity (H4-K8 specific)
GO:0044545 NSL complex
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046972 histone acetyltransferase activity (H4-K16 specific)
GO:0051974 negative regulation of telomerase activity
GO:0071339 MLL1 complex
GO:1904357 negative regulation of telomere maintenance via telomere lengthening
GO:1904751 positive regulation of protein localization to nucleolus
|
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 462 amino acids |
| FASTA sequence | >sp|Q96EZ8|MCRS1_HUMAN Microspherule protein 1 OS=Homo sapiens OX=9606 GN=MCRS1 PE=1 SV=1
MDKDSQGLLDSSLMASGTASRSEDEESLAGQKRASSQALGTIPKRRSSSRFIKRKKFDDE
LVESSLAKSSTRAKGASGVEPGRCSGSEPSSSEKKKVSKAPSTPVPPSPAPAPGLTKRVK
KSKQPLQVTKDLGRWKPADDLLLINAVLQTNDLTSVHLGVKFSCRFTLREVQERWYALLY
DPVISKLACQAMRQLHPEAIAAIQSKALFSKAEEQLLSKVGSTSQPTLETFQDLLHRHPD
AFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEV
LEHELMVADRRQKREIRQLEQELHKWQVLVDSITGMSSPDFDNQTLAVLRGRMVRYLMRS
REITLGRATKDNQIDVDLSLEGPAWKISRKQGVIKLKNNGDFFIANEGRRPIYIDGRPVL
CGSKWRLSNNSVVEIASLRFVFLINQDLIALIRAEAAKITPQ |
| Structure Information |
| PDB ID | None |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_444_uniID_Q96EZ8 is 462 residues long, with 141 residues (30.52%) predicted as disordered.The protein has 1 short (< 30 residues) disorder segment and 1 long (>= 30 residues) disorder segment.
Segment 1 - Long (>= 30 residues) disordered segment Segment is located between positions 1 and 136 in the sequence. The segment is 136 residues long (29.44 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment Segment is located between positions 458 and 462 in the sequence. The segment is 5 residues long (1.08 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | part of the NSL complex, which acetylates nucleosomal histone H4 on lysine residues |
| References for function | 20018852 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | nucleus |
| Comments | NA |
| Function 2 |
| Function description | component of KANSL complex located at Spindle poles; KANSL1 and KANSL3 bind MT minus ends |
| References for function | 22081094 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | spindle poles |
| Comments | NA |