| General Information |
| MoonProt ID | 445 |
| First appeared in release | 3.0 |
| Name(s) | WD repeat-containing protein 5
Gene
WDR5 |
| UniProt ID | P61964 (WDR5_HUMAN) |
| GO terms | GO:0051571 positive regulation of histone H3-K4 methylation
GO:0051572 negative regulation of histone H3-K4 methylation
GO:0042393 histone binding
GO:0051568 histone H3-K4 methylation
GO:0048188 Set1C/COMPASS complex
GO:0005634 nucleus
GO:0051568 histone H3-K4 methylation
GO:0048188 Set1C/COMPASS complex
GO:0046972 histone acetyltransferase activity (H4-K16 specific)
GO:0043996 histone acetyltransferase activity (H4-K8 specific)
GO:0043984 histone H4-K16 acetylation
GO:0043982 histone H4-K8 acetylation
GO:0043981 histone H4-K5 acetylation
GO:0000123 histone acetyltransferase complex
GO:0071339 MLL1 complex
GO:0043995 histone acetyltransferase activity (H4-K5 specific)
GO:0035097 histone methyltransferase complex
GO:0035064 methylated histone binding
GO:0005515 protein binding
GO:0044666 MLL3/4 complex
GO:0006325 chromatin organization
GO:0005634 nucleus
GO:0035097 histone methyltransferase complex
GO:0005654 nucleoplasm
GO:0043687 post-translational protein modification
GO:0045652 regulation of megakaryocyte differentiation
GO:0005515 protein binding
GO:0051568 histone H3-K4 methylation
GO:0005634 nucleus
GO:0045722 positive regulation of gluconeogenesis
GO:0001501 skeletal system development
GO:0031175 neuron projection development
GO:0005671 Ada2/Gcn5/Ada3 transcription activator complex
GO:0043966 histone H3 acetylation
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0035064 methylated histone binding
GO:0042800 histone methyltransferase activity (H3-K4 specific)
GO:0005515 protein binding
GO:0035097 histone methyltransferase complex
GO:0051568 histone H3-K4 methylation
|
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 334 amino acids |
| FASTA sequence | >sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWL
ASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK
CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN
RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKL
WDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH
TDVVISTACHPTENIIASAALENDKTIKLWKSDC |
| Structure Information |
| PDB ID | 2XL2, 2GNQ, 5M23, 3PSL, 4A7J, 4GM3, 6PG3, |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | 2.130.10.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-30), and C terminus (aa 330-334) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | part of the MLL1/MLL complex, which methylates and dimethylates lysine 4 of histone H3 |
| References for function | 19556245 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | nucleus |
| Comments | NA |
| Function 2 |
| Function description | binds to KIF2A, PRC1, MKLP1, CYK4, and CEP55 |
| References for function | 25666610 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | Centrosomes, Spindle, Central spindle and Midbody |
| Comments | NA |