| General Information |
| MoonProt ID | 446 |
| First appeared in release | 3.0 |
| Name(s) | Pre-mRNA-splicing factor SPF27
Gene
bcas2 |
| UniProt ID | Q6PBE2 (SPF27_XENTR) |
| GO terms | GO:0071013 catalytic step 2 spliceosome
GO:0000974 Prp19 complex
GO:0000398 mRNA splicing, via spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0005634 nucleus
GO:0006397 mRNA processing
GO:0005681 spliceosomal complex
GO:0008380 RNA splicing
GO:0006397 mRNA processing
|
| Organisms for which functions have been demonstrated | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Sequence length | 223 amino acids |
| FASTA sequence | >sp|Q6PBE2|SPF27_XENTR Pre-mRNA-splicing factor SPF27 OS=Xenopus tropicalis OX=8364 GN=bcas2 PE=2 SV=1
MAGTSLVAGDVVVDALPYFDQGYDAQGVREAAAALVEEETRRYRPTKNYLSYLPTPDYSA
FETEIMRNEFERLSSRQPLELLSMKRYELPAPLSGQRNDITAWQECVNNSMAQLEHQAVR
IENLELMSQHGCNAWKVYNENLLHMIDCAQKDLQKLRKKIQDLNWQRKNSQLTAGARLRE
MESTWVSLVSKNYEIERAIVQMENEVYQLKERSGENKENIEDY |
| Structure Information |
| PDB ID | closest is human with 87% identity |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_446_uniID_Q6PBE2 is 223 residues long, with 35 residues (15.70%) predicted as disordered.The protein has 3 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment Segment is located between positions 1 and 5 in the sequence. The segment is 5 residues long (2.24 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment Segment is located between positions 41 and 50 in the sequence. The segment is 10 residues long (4.48 % of the total sequence length).
Segment 3 - Short (< 30 residues) disordered segment Segment is located between positions 204 and 223 in the sequence. The segment is 20 residues long (8.97 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of spliceosome, conserved Prp19 (pre-RNA processing 19) complex is required for pre-mRNA splicing in eukaryotic nuclei |
| References for function | 20595234 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | NA |
| Comments | NA |
| Function 2 |
| Function description | without it see Defective chromatin-MT interaction; morphologically abnormal spindles in Xenopus egg extracts |
| References for function | 24069358 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | spindle |
| Comments | NA |