Protein Information

General Information
MoonProt ID46
First appeared in release1.0
Name(s)Fructose-bisphosphate aldolase FBP aldolase FBPA 37 kDa major allergen Fructose-1,6-bisphosphate aldolase IgE-binding allergen Gene Name: FBA1
UniProt IDQ9URB4 (ALF_CANAL), Reviewed
GO termsGO:0005975 carbohydrate metabolic process GO:0006096 glycolysis GO:0044416 induction by symbiont of host defense response GO:0051701 interaction with host GO:0003824 catalytic activity GO:0004332 fructose-bisphosphate aldolase activity GO:0005515 protein binding GO:0008270 zinc ion binding GO:0016829 lyase activity GO:0016832 aldehyde-lyase activity GO:0046872 metal ion binding GO:0005737 cytoplasm GO:0005886 plasma membrane GO:0009277 fungal-type cell wall GO:0009986 cell surface GO:0030446 hyphal cell wall
Organisms for which functions have been demonstratedCandida albicans
Sequence length359
FASTA sequence>sp|Q9URB4|ALF_CANAL Fructose-bisphosphate aldolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FBA1 PE=1 SV=2 MAPPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFDGMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEILGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGIRDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionFructose bisphosphate aldolase, enzyme D-fructose 1,6-bisphosphate <=> dihydroxyacetone phosphate + D-glyceraldehyde 3-phosphate Catalyzes the aldol condensation of dihydroxyacetone phosphate (DHAP) with glyceraldehyde 3-phosphate (G3P) to form fructose 1,6-bisphosphate (FBP) in gluconeogenesis and the reverse reaction in glycolysis Carbohydrate degradation, glycolysis, gluconeogenesis
References for function
E.C. number4.1.2.13
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionCrowe, J.D. et al. (2003) Candida albicans binds human plasminogen: identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51. PMID:12622818
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments