General Information |
MoonProt ID | 46 |
First appeared in release | 1.0 |
Name(s) | Fructose-bisphosphate aldolase
FBP aldolase
FBPA
37 kDa major allergen
Fructose-1,6-bisphosphate aldolase
IgE-binding allergen
Gene Name: FBA1
|
UniProt ID | Q9URB4 (ALF_CANAL), Reviewed |
GO terms | GO:0005975 carbohydrate metabolic process
GO:0006096 glycolysis
GO:0044416 induction by symbiont of host defense response
GO:0051701 interaction with host
GO:0003824 catalytic activity
GO:0004332 fructose-bisphosphate aldolase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016829 lyase activity
GO:0016832 aldehyde-lyase activity
GO:0046872 metal ion binding
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009277 fungal-type cell wall
GO:0009986 cell surface
GO:0030446 hyphal cell wall |
Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
Sequence length | 359 |
FASTA sequence | >sp|Q9URB4|ALF_CANAL Fructose-bisphosphate aldolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FBA1 PE=1 SV=2
MAPPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFDGMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEILGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGIRDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL |
Structure Information |
PDB ID | closest is E.coli with 55% amino acid sequence identity |
Quaternary structure | |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-7, 355-359 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Fructose bisphosphate aldolase, enzyme
D-fructose 1,6-bisphosphate <=> dihydroxyacetone phosphate + D-glyceraldehyde 3-phosphate
Catalyzes the aldol condensation of dihydroxyacetone phosphate (DHAP) with glyceraldehyde 3-phosphate (G3P) to form fructose 1,6-bisphosphate (FBP) in gluconeogenesis and the reverse reaction in glycolysis
Carbohydrate degradation, glycolysis, gluconeogenesis
|
References for function | |
E.C. number | 4.1.2.13 |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | plasminogen binding |
References for function | Crowe, J.D. et al. (2003) Candida albicans binds human plasminogen:
identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51.
PMID:12622818 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cell surface |
Comments | |