| General Information |
| MoonProt ID | 460 |
| First appeared in release | 3.0 |
| Name(s) | Transaldolase |
| UniProt ID | Q8G6C9 |
| GO terms | GO:0016740 transferase activity
GO:0006098 pentose-phosphate shunt
GO:0005737 cytoplasm
GO:0004801 sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity |
| Organisms for which functions have been demonstrated | Bifidobacterium longum (strain NCC 2705) (Gram positive bacterium) |
| Sequence length | 367 amino acids |
| FASTA sequence | >tr|Q8G6C9|Q8G6C9_BIFLO Transaldolase OS=Bifidobacterium longum (strain NCC 2705) OX=206672 GN=tal PE=3 SV=1
MTEATQRTSDNGVSIWLDDLSRSRIESGSLQDLIANKNVVGVTTNPSIFQKALSQVGPYDAQLKELGKVDVETAVRELTTTDVRNATDIFREIAEATDFVDGRVSIEVDPRLAHDTENTAKQAVELWEKVNRPNAMIKIPATLEGLPAITATLAKGISVNVTLIFSLERYEQVIDAYIEGIAQAAANGHDLKHIGSVASFFVSRVDTAVDKLLEANGSDEAKALEGKAAVANARLAYELFEKKFAEDPRWADLAAKGAKVQRPLWASTGTKNAAYSDCKYVDELVAKHIVNTMPEKTLNALADHGNGAPSIEGTYEESHAIINKLAELGINLKDVTDKLEADGVAAFIKSWDSVLSDVQSGIDRVNA |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-8), and C terminus (aa 362-367) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Transferase.
Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway. |
| References for function | Ventura M, Canchaya C, Zhang Z, Fitzgerald GF, van Sinderen D. Molecular characterization of hsp20, encoding a small heat shock protein of Bifidobacterium breve UCC2003. Applied and environmental microbiology. 2007 Jul 15;73(14):4695-703. |
| E.C. number | 2.2.1.2 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | Binds mucin |
| References for function | Nishiyama K, Takaki T, Sugiyama M, Fukuda I, Aiso M, Mukai T, Odamaki T, Xiao JZ, Osawa R, Okada N. Extracellular vesicles produced by Bifidobacterium longum export mucin-binding proteins. Appl Environ Microbiol. 2020 Jul 31:AEM.01464-20. doi: 10.1128/AEM.01464-20. Epub ahead of print. PMID: 32737132. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | extracellular |
| Comments | |