| General Information |
| MoonProt ID | 461 |
| First appeared in release | 3.0 |
| Name(s) | Hsp20
heat shock protein 20 |
| UniProt ID | Q8G6R2 |
| GO terms | NA |
| Organisms for which functions have been demonstrated | Bifidobacterium longum (strain NCC 2705) (Gram positive bacterium) |
| Sequence length | 167 amino acids |
| FASTA sequence | >tr|Q8G6R2|Q8G6R2_BIFLO Probable Hsp20-family heat shock chaperone OS=Bifidobacterium longum (strain NCC 2705) OX=206672 GN=BL0576 PE=3 SV=1
MAMFPALMNDTMFSDLFDDPFFEGWRNTDNTMSAVMPANMMTTDVRETDKGYDVDIDMPGFKKEDINLELNNGYLTVSASRCSEHEDKAPAAEDEASDSKCACASDSGKWLRRERYMGSCSRSFYVGEDVKESDIHASYRNGTLCIQVPKMQAQPQVESKHQIAIEG |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | Use FASTA sequence on MFDp2 webserver.
trQ8G6R2Q8G6R2_BIFLO_Pro is 167 residues long, with 33 residues (19.76 %) predicted as disordered. The protein has 2 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment
Segment is located between positions 86 and 101 in the sequence.
The segment is 16 residues long (9.58 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment
Segment is located between positions 151 and 167 in the sequence.
The segment is 17 residues long (10.18 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | heat shock protein |
| References for function | Ventura M, Canchaya C, Zhang Z, Fitzgerald GF, van Sinderen D. Molecular characterization of hsp20, encoding a small heat shock protein of Bifidobacterium breve UCC2003. Applied and environmental microbiology. 2007 Jul 15;73(14):4695-703. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds mucin |
| References for function | Nishiyama K, Takaki T, Sugiyama M, Fukuda I, Aiso M, Mukai T, Odamaki T, Xiao JZ, Osawa R, Okada N. Extracellular vesicles produced by Bifidobacterium longum export mucin-binding proteins. Appl Environ Microbiol. 2020 Jul 31:AEM.01464-20. doi: 10.1128/AEM.01464-20. Epub ahead of print. PMID: 32737132. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | extracellular |
| Comments | |