General Information |
MoonProt ID | 462 |
First appeared in release | 3.0 |
Name(s) | Probable 23S rRNA methyltransferase Erm(37).
Gene: erm(37) |
UniProt ID | Q10838 (Q10838_MYCTU) |
GO terms | GO:0032259 methylation
GO:0016740 transferase activity
GO:0008168 methyltransferase activity
GO:0003723 RNA binding
GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity
GO:0031167 rRNA methylation |
Organisms for which functions have been demonstrated | Mycobacterium tuberculosis (mycobacterium, causes tuberculosis) |
Sequence length | 179 amino acids |
FASTA sequence | >tr|Q10838|Q10838_MYCTU Probable 23S rRNA methyltransferase Erm(37) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=erm(37) PE=3 SV=1
MSALGRSRRAWGWHRLHDEWAARVVSAAAVRPGELVFDIGAGEGALTAHLVRAGARVVAVELHPRRVGVLRERFPGITVVHADAASIRLPGRPFRVVANPPYGISSRLLRTLLAPNSGLVAADLVLQRALVCKFASRNARRFTLTVGLMLPRRAFLPPPHVDSAVLVVRRRKCGDWQGR |
Structure Information |
PDB ID | NA |
Quaternary structure | NA |
SCOP | |
CATH | |
TM Helix Prediction | no TM helices
# tr|Q10838|Q10838_MYCTU Number of predicted TMHs: 0
# tr|Q10838|Q10838_MYCTU Exp number of AAs in TMHs: 0.12007
# tr|Q10838|Q10838_MYCTU Exp number, first 60 AAs: 0.0075
# tr|Q10838|Q10838_MYCTU Total prob of N-in: 0.23696
tr|Q10838|Q10838_MYCTU TMHMM2.0 outside 1 179 |
DisProt Annotation | |
Predicted Disorder Regions | Use FASTA sequence on MFDp2 webserver.
trQ10838Q10838_MYCTU_Pro is 179 residues long, with 9 residues (5.03 %) predicted as disordered. The protein has 2 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment
Segment is located between positions 1 and 5 in the sequence.
The segment is 5 residues long (2.79 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment
Segment is located between positions 176 and 179 in the sequence.
The segment is 4 residues long (2.23 % of the total sequence length). |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | 23S rRNA Methyltransferase.
The 179-amino-acid long protein deduced from Rv1988 presents similarity with the Erm protein family, members of which confer macrolide, lincosamide, streptogramin B resistance by methylation of the 23S rRNA at a highly conserved adenine nucleotide (A2058 [E. coli numbering]). |
References for function | Buriánková K, Doucet-Populaire F, Dorson O, Gondran A, Ghnassia JC, Weiser J, Pernodet JL. Molecular basis of intrinsic macrolide resistance in the Mycobacterium tuberculosis complex. Antimicrob Agents Chemother. 2004 Jan;48(1):143-50. doi: 10.1128/aac.48.1.143-150.2004. PMID: 14693532; PMCID: PMC310192. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | |
Comments | Rv1988 also known as Erm37, Mycobacterium tuberculosis H37Rv - methylates the primarly target A2058 and the neighbouring nucleotides A2057 and A2059 of the 23S rRNA of M. tuberculosis and thus reducing the binding affininty of the antibiotics macrolide/lincosamide/streptogramin towards the 23S rRNA. |
Function 2 |
Function description | Dimethylates arginine 42 of histone H3 in host cells |
References for function | Yaseen I, Kaur P, Nandicoori VK, Khosla S. Mycobacteria modulate host epigenetic machinery by Rv1988 methylation of a non-tail arginine of histone H3. Nat Commun. 2015 Nov 16;6:8922. doi: 10.1038/ncomms9922. PMID: 26568365. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | secreted into host cell |
Comments | |