General Information |
MoonProt ID | 474 |
First appeared in release | 3.0 |
Name(s) | ADT5
Arogenate dehydratase 5, chloroplastic. |
UniProt ID | Q9FNJ8 (AROD5_ARATH) |
GO terms | GO:0008652 cellular amino acid biosynthetic process
GO:0016829 lyase activity
GO:0009507 chloroplast
GO:0009536 plastid
GO:0009094 L-phenylalanine biosynthetic process
GO:0009073 aromatic amino acid family biosynthetic process
GO:0047769 arogenate dehydratase activity
GO:0009570 chloroplast stroma |
Organisms for which functions have been demonstrated | Arabidopsis thaliana (Mouse-ear cress, a plant) |
Sequence length | 425 amino acids |
FASTA sequence | >sp|Q9FNJ8|AROD5_ARATH Arogenate dehydratase 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ADT5 PE=1 SV=1
MQTISPAFSCDLKSVIQPNLTAKKARYSHVNGKRVSVRCSYRSESFSFPNGVGSSRADWQSSCAILASKVVSAENSSSVAVVNGHSNGSVDLSLVPSKSQHNGKPGLIQPLTITDLSPAPSHGSTLRVAYQGVPGAYSEAAAGKAYPNSEAIPCDQFDVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQIPVHHCLLALPGVRTDCITRVISHPQALAQTEGSLNKLTPKAAIEAFHDTAAAAEYIAANNLHDTAAVASARAAELYGLQILADGIQDDAGNVTRFLMLARDPIIPRTDRPFKTSIVFAAQEHKGTSVLFKVLSAFAFRNISLTKIESRPHQNCPVRVVGDENVGTSKHFEYTFYVDFEASMAEARAQNALAEVQEYTSFLRVLGSYPMDMTPWSTLPSEDV |
Structure Information |
PDB ID | NA |
Quaternary structure | NA |
SCOP | |
CATH | |
TM Helix Prediction | no TM helices |
DisProt Annotation | |
Predicted Disorder Regions | Use FASTA sequence on MFDp2 webserver.
spQ9FNJ8AROD5_ARATH_Arog is 425 residues long, with 24 residues (5.65 %) predicted as disordered. The protein has 3 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment
Segment is located between positions 1 and 12 in the sequence.
The segment is 12 residues long (2.82 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment
Segment is located between positions 92 and 97 in the sequence.
The segment is 6 residues long (1.41 % of the total sequence length).
Segment 3 - Short (< 30 residues) disordered segment
Segment is located between positions 420 and 425 in the sequence.
The segment is 6 residues long (1.41 % of the total sequence length). |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Arogenate dehydratase. |
References for function | Cho MH, Corea OR, Yang H, Bedgar DL, Laskar DD, Anterola AM, Moog-Anterola FA, Hood RL, Kohalmi SE, Bernards MA, Kang C, Davin LB, Lewis NG. Phenylalanine biosynthesis in Arabidopsis thaliana. Identification and characterization of arogenate dehydratases. J Biol Chem. 2007 Oct 19;282(42):30827-35. doi: 10.1074/jbc.M702662200. Epub 2007 Aug 28. PMID: 17726025. |
E.C. number | 4.2.1.91 |
Location of functional site(s) | |
Cellular location of function | chloroplast stroma. |
Comments | |
Function 2 |
Function description | transcriptional regulator. |
References for function | Bross CD, Howes TR, Abolhassani Rad S, Kljakic O, Kohalmi SE. Subcellular localization of Arabidopsis arogenate dehydratases suggests novel and non-enzymatic roles. J Exp Bot. 2017 Mar 1;68(7):1425-1440. doi: 10.1093/jxb/erx024. PMID: 28338876; PMCID: PMC5444438. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | ADT5 was also found in nuclei. ADT5 is transported to the nucleus via stromules. |
Comments | |