| General Information |
| MoonProt ID | 487 |
| First appeared in release | 3.0 |
| Name(s) | Bifunctional riboflavin kinase/FMN adenylyltransferase; ribF |
| UniProt ID | Q59263 (RIBF_CORAM) |
| GO terms | GO:0003919 FMN adenylyltransferase activity
GO:0008531 riboflavin kinase activity
GO:0009231 riboflavin biosynthetic process
GO:0016740 transferase activity
GO:0016779 nucleotidyltransferase activity
GO:0016301 kinase activity
GO:0008152 metabolic process
GO:0016310 phosphorylation
GO:0003824 catalytic activity
GO:0005524 ATP binding
GO:0000166 nucleotide binding
GO:0009398 FMN biosynthetic process
GO:0006747 FAD biosynthetic process |
| Organisms for which functions have been demonstrated | Corynebacterium ammoniagenes (Brevibacterium ammoniagenes) |
| Sequence length | 338 amino acids |
| FASTA sequence | >sp|Q59263|RIBF_CORAM Bifunctional riboflavin kinase/FMN adenylyltransferase OS=Corynebacterium ammoniagenes OX=1697 GN=ribF PE=1 SV=1
MDIWYGTAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSRLTVDVIDLLDDEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAES |
| Structure Information |
| PDB ID | 2X0K |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices
# sp|Q59263|RIBF_CORAM Number of predicted TMHs: 0
# sp|Q59263|RIBF_CORAM Exp number of AAs in TMHs: 0.00674
# sp|Q59263|RIBF_CORAM Exp number, first 60 AAs: 0.00139
# sp|Q59263|RIBF_CORAM Total prob of N-in: 0.02225
sp|Q59263|RIBF_CORAM TMHMM2.0 outside 1 338 |
| DisProt Annotation | |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
sp_Q59263_RIBF_CORAM_Bif is 338 residues long, with 7 residues (2.07 %) predicted as disordered. The protein has 1 short (< 30 residues) disorder segment and 0 long (>= 30 residues) disorder segments. |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Catalyzes the phosphorylation of riboflavin to FMN followed by the adenylation of FMN to FAD |
| References for function | Manstein DJ, Pai EF. Purification and characterization of FAD synthetase from Brevibacterium ammoniagenes. Journal of Biological Chemistry. 1986 Dec 5;261(34):16169-73. |
| E.C. number | 2.7.1.26 |
| Location of functional site(s) | |
| Cellular location of function | mitochondria outer membrane |
| Comments | |
| Function 2 |
| Function description | Corynebacterium ammoniagenes (Brevibacterium ammoniagenes) |
| References for function | Collins MD. Transfer of Brevibacterium ammoniagenes (Cooke and Keith) to the Genus Corynebacterium as Corynebacterium ammoniagenes comb. nov. International Journal of Systematic and Evolutionary Microbiology. 1987 Oct 1;37(4):442-3. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | bacteria membrane |
| Comments | |