| General Information |
| MoonProt ID | 491 |
| First appeared in release | 3.0 |
| Name(s) | Bifunctional riboflavin kinase/FMN adenylyltransferase
Gene: ribF Synonyms:yaaC
Recommended name:
Bifunctional riboflavin kinase/FMN adenylyltransferase
Alternative name(s):
Riboflavin biosynthesis protein RibF
Including the following 2 domains:
Riboflavin kinase (EC:2.7.1.26)
Alternative name(s):
Flavokinase
FMN adenylyltransferase (EC:2.7.7.2)
Alternative name(s):
FAD pyrophosphorylase
FAD synthase |
| UniProt ID | P0AG40 (RIBF_ECOLI) |
| GO terms | GO:0016740 transferase activity
GO:0016779 nucleotidyltransferase activity
GO:0016301 kinase activity
GO:0008152 metabolic process
GO:0000166 nucleotide binding
GO:0016310 phosphorylation
GO:0003824 catalytic activity
GO:0005524 ATP binding
GO:0008531 riboflavin kinase activity
GO:0003919 FMN adenylyltransferase activity
GO:0009398 FMN biosynthetic process
GO:0006747 FAD biosynthetic process |
| Organisms for which functions have been demonstrated | Escherichia coli (strain K12) |
| Sequence length | 313 amino acids |
| FASTA sequence | >sp|P0AG40|RIBF_ECOLI Bifunctional riboflavin kinase/FMN adenylyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=ribF PE=1 SV=1
MKLIRGIHNLSQAPQEGCVLTIGNFDGVHRGHRALLQGLQEEGRKRNLPVMVMLFEPQPL
ELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTAQNFISDLLVKHLRVKF
LAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVRISSTAVRQALADDNLAL
AESLLGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVKGVYAVEVLGLGEKPLPGV
ANIGTRPTVAGIRQQLEVHLLDVAMDLYGRHIQVVLRKKIRNEQRFASLDELKAQIARDE
LTAREFFGLTKPA |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices
# sp|P0AG40|RIBF_ECOLI Number of predicted TMHs: 0
# sp|P0AG40|RIBF_ECOLI Exp number of AAs in TMHs: 0.002
# sp|P0AG40|RIBF_ECOLI Exp number, first 60 AAs: 0.00037
# sp|P0AG40|RIBF_ECOLI Total prob of N-in: 0.01824
sp|P0AG40|RIBF_ECOLI TMHMM2.0 outside 1 313 |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-6), and C terminus (aa 307-313) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ATP-dependent riboflavin kinase |
| References for function | Kamio Y, Lin CK, Regue M, Wu HC. Characterization of the ileS-lsp operon in Escherichia coli. Identification of an open reading frame upstream of the ileS gene and potential promoter(s) for the ileS-lsp operon. J Biol Chem. 1985 May 10;260(9):5616-20. PMID: 2985604. |
| E.C. number | 2.7.1.26 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | FAD synthetase |
| References for function | Kamio Y, Lin CK, Regue M, Wu HC. Characterization of the ileS-lsp operon in Escherichia coli. Identification of an open reading frame upstream of the ileS gene and potential promoter(s) for the ileS-lsp operon. J Biol Chem. 1985 May 10;260(9):5616-20. PMID: 2985604. |
| E.C. number | 2.7.7.2 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |