| General Information |
| MoonProt ID | 494 |
| First appeared in release | 3.0 |
| Name(s) | Tudor-interacting repair regulator protein
Gene: NUDT16L1 Synonyms:SDOS, TIRR
Recommended name:
Tudor-interacting repair regulator protein
Alternative name(s):
NUDT16-like protein 1
Protein syndesmos |
| UniProt ID | Q9BRJ7 (TIRR_HUMAN) |
| GO terms | GO:0050072 m7G(5')pppN diphosphatase activity
GO:0042803 protein homodimerization activity
GO:0030515 snoRNA binding
GO:0050072 m7G(5')pppN diphosphatase activity
GO:0005634 nucleus
GO:2001033 negative regulation of double-strand break repair via nonhomologous end joining
GO:0005515 protein binding
GO:0003723 RNA binding |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 211 amino acids |
| FASTA sequence | >sp|Q9BRJ7|TIRR_HUMAN Tudor-interacting repair regulator protein OS=Homo sapiens OX=9606 GN=NUDT16L1 PE=1 SV=1
MSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASS |
| Structure Information |
| PDB ID | 3KVH,
5ZCJ,
6CO1,
6D0L. |
| Quaternary structure | NA |
| SCOP | 1 domain.
class 1000001 All beta proteins
fold 2000090 SH3-like barrel
superfamily 3000404 Tudor/PWWP/MBT domain-like
family 4003195 Tudor domain
domain 8029261 This domain is represented by 2G3R A:1485-1537 TP53-binding protein 1. Species Homo sapiens. |
| CATH | 1 Matching CATH Superfamily.
Superfamily: 3.90.79.10. Nucleoside Triphosphate Pyrophosphohydrolase.
1 Matching CATH Domain.
Domain: 3kvhA00 PDB code 3kvh, chain A, domain 00. Superfamily: 3.90.79.10. |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
spQ9BRJ7TIRR_HUMAN_Tudor is 211 residues long, with 17 residues (8.06 %) predicted as disordered. The protein has 2 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments.
Segment 1 - Short (< 30 residues) disordered segment
Segment is located between positions 1 and 4 in the sequence.
The segment is 4 residues long (1.90 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment
Segment is located between positions 199 and 211 in the sequence.
The segment is 13 residues long (6.16 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | 617338 |
| Function 1 |
| Function description | Syndesmos, interacts with p53 binding protein 1 (53BP1) and regulates its recruitment to chromatin. |
| References for function | Drané P, Brault ME, Cui G, Meghani K, Chaubey S, Detappe A, Parnandi N, He Y, Zheng XF, Botuyan MV, Kalousi A, Yewdell WT, Münch C, Harper JW, Chaudhuri J, Soutoglou E, Mer G, Chowdhury D. TIRR regulates 53BP1 by masking its histone methyl-lysine binding function. Nature. 2017 Mar 9;543(7644):211-216. doi: 10.1038/nature21358. Epub 2017 Feb 27. PMID: 28241136; PMCID: PMC5441565. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | Syndesmos (SDOS) directly interacts with p53 binding protein 1 (53BP1) and regulates its recruitment to chromatin. |
| Function 2 |
| Function description | Binds RNA |
| References for function | Drané P, Brault ME, Cui G, Meghani K, Chaubey S, Detappe A, Parnandi N, He Y, Zheng XF, Botuyan MV, Kalousi A, Yewdell WT, Münch C, Harper JW, Chaudhuri J, Soutoglou E, Mer G, Chowdhury D. TIRR regulates 53BP1 by masking its histone methyl-lysine binding function. Nature. 2017 Mar 9;543(7644):211-216. doi: 10.1038/nature21358. Epub 2017 Feb 27. PMID: 28241136; PMCID: PMC5441565. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | Herein, we report that SDOS is a novel RNA-binding protein (RBP) that interacts with TRAP1 at the ER. PMID: 30260431. |