| General Information |
| MoonProt ID | 497 |
| First appeared in release | 3.0 |
| Name(s) | Protein S100-A9
Gene:S100a9 Synonyms:Cagb, Mrp14
Recommended name:
Protein S100-A9
Alternative name(s):
Calgranulin-B
Leukocyte L1 complex heavy chain
Migration inhibitory factor-related protein 14
Short name:
MRP-14
Short name:
p14
S100 calcium-binding protein A9 |
| UniProt ID | P31725 (S10A9_MOUSE) |
| GO terms | GO:0006417 regulation of translation
GO:0050729 positive regulation of inflammatory response
GO:0030593 neutrophil chemotaxis
GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0002523 leukocyte migration involved in inflammatory response
GO:0018119 peptidyl-cysteine S-nitrosylation
GO:0070488 neutrophil aggregation
GO:0006914 autophagy
GO:0002376 immune system process
GO:0005576 extracellular region
GO:0045087 innate immune response
GO:0046872 metal ion binding
GO:0005856 cytoskeleton
GO:0006915 apoptotic process
GO:0006935 chemotaxis
GO:0016020 membrane
GO:0005886 plasma membrane
GO:0016209 antioxidant activity
GO:0005737 cytoplasm
GO:0006954 inflammatory response
GO:0005737 cytoplasm
GO:2001244 positive regulation of intrinsic apoptotic signaling pathway |
| Organisms for which functions have been demonstrated | Mus musculus (Mouse) |
| Sequence length | 113 amino acids |
| FASTA sequence | >sp|P31725|S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | (7-24) signal sequence |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-13), middle region (aa 15-36), and C terminus (aa 103-113) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | binds toToll-like receptor four TLR4, amplifies inflammation |
| References for function | Harman JL, Loes AN, Warren GD, Heaphy MC, Lampi KJ, Harms MJ. Evolution of multifunctionality through a pleiotropic substitution in the innate immune protein S100A9. Elife. 2020 Apr 7;9:e54100. doi: 10.7554/eLife.54100. PMID: 32255429; PMCID: PMC7213983. |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |
| Function 2 |
| Function description | part of a heterocomplex with S100A8 to drive inflammation, antimicrobial |
| References for function | Harman JL, Loes AN, Warren GD, Heaphy MC, Lampi KJ, Harms MJ. Evolution of multifunctionality through a pleiotropic substitution in the innate immune protein S100A9. Elife. 2020 Apr 7;9:e54100. doi: 10.7554/eLife.54100. PMID: 32255429; PMCID: PMC7213983. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |