Protein Information

General Information
MoonProt ID497
First appeared in release3.0
Name(s)Protein S100-A9 Gene:S100a9 Synonyms:Cagb, Mrp14 Recommended name: Protein S100-A9 Alternative name(s): Calgranulin-B Leukocyte L1 complex heavy chain Migration inhibitory factor-related protein 14 Short name: MRP-14 Short name: p14 S100 calcium-binding protein A9
UniProt IDP31725 (S10A9_MOUSE)
GO termsGO:0006417 regulation of translation GO:0050729 positive regulation of inflammatory response GO:0030593 neutrophil chemotaxis GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process GO:0002523 leukocyte migration involved in inflammatory response GO:0018119 peptidyl-cysteine S-nitrosylation GO:0070488 neutrophil aggregation GO:0006914 autophagy GO:0002376 immune system process GO:0005576 extracellular region GO:0045087 innate immune response GO:0046872 metal ion binding GO:0005856 cytoskeleton GO:0006915 apoptotic process GO:0006935 chemotaxis GO:0016020 membrane GO:0005886 plasma membrane GO:0016209 antioxidant activity GO:0005737 cytoplasm GO:0006954 inflammatory response GO:0005737 cytoplasm GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
Organisms for which functions have been demonstratedMus musculus (Mouse)
Sequence length113 amino acids
FASTA sequence>sp|P31725|S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3 MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
Structure Information
PDB IDNA
Quaternary structureNA
SCOP
CATH
TM Helix Prediction(7-24) signal sequence
DisProt Annotation
Predicted Disorder RegionsUse FASTA sequence on the MFDp2 webserver. spP31725S10A9_MOUSE_Prot is 113 residues long, with 80 residues (70.80 %) predicted as disordered. The protein has 1 short (< 30 residues) disorder segment and 1 long (>= 30 residues) disorder segment. Segment 1 - Long (>= 30 residues) disordered segment Segment is located between positions 1 and 51 in the sequence. The segment is 51 residues long (45.13 % of the total sequence length). Segment 2 - Short (< 30 residues) disordered segment Segment is located between positions 85 and 113 in the sequence. The segment is 29 residues long (25.66 % of the total sequence length).
Connections to Disease
OMIM ID
Function 1
Function descriptionbinds toToll-like receptor four TLR4, amplifies inflammation
References for functionHarman JL, Loes AN, Warren GD, Heaphy MC, Lampi KJ, Harms MJ. Evolution of multifunctionality through a pleiotropic substitution in the innate immune protein S100A9. Elife. 2020 Apr 7;9:e54100. doi: 10.7554/eLife.54100. PMID: 32255429; PMCID: PMC7213983.
E.C. number
Location of functional site(s)
Cellular location of function
Comments
Function 2
Function descriptionpart of a heterocomplex with S100A8 to drive inflammation, antimicrobial
References for functionHarman JL, Loes AN, Warren GD, Heaphy MC, Lampi KJ, Harms MJ. Evolution of multifunctionality through a pleiotropic substitution in the innate immune protein S100A9. Elife. 2020 Apr 7;9:e54100. doi: 10.7554/eLife.54100. PMID: 32255429; PMCID: PMC7213983.
E.C. number
Location of functional site(s)
Cellular location of function
Comments