General Information |
MoonProt ID | 497 |
First appeared in release | 3.0 |
Name(s) | Protein S100-A9
Gene:S100a9 Synonyms:Cagb, Mrp14
Recommended name:
Protein S100-A9
Alternative name(s):
Calgranulin-B
Leukocyte L1 complex heavy chain
Migration inhibitory factor-related protein 14
Short name:
MRP-14
Short name:
p14
S100 calcium-binding protein A9 |
UniProt ID | P31725 (S10A9_MOUSE) |
GO terms | GO:0006417 regulation of translation
GO:0050729 positive regulation of inflammatory response
GO:0030593 neutrophil chemotaxis
GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0002523 leukocyte migration involved in inflammatory response
GO:0018119 peptidyl-cysteine S-nitrosylation
GO:0070488 neutrophil aggregation
GO:0006914 autophagy
GO:0002376 immune system process
GO:0005576 extracellular region
GO:0045087 innate immune response
GO:0046872 metal ion binding
GO:0005856 cytoskeleton
GO:0006915 apoptotic process
GO:0006935 chemotaxis
GO:0016020 membrane
GO:0005886 plasma membrane
GO:0016209 antioxidant activity
GO:0005737 cytoplasm
GO:0006954 inflammatory response
GO:0005737 cytoplasm
GO:2001244 positive regulation of intrinsic apoptotic signaling pathway |
Organisms for which functions have been demonstrated | Mus musculus (Mouse) |
Sequence length | 113 amino acids |
FASTA sequence | >sp|P31725|S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK |
Structure Information |
PDB ID | NA |
Quaternary structure | NA |
SCOP | |
CATH | |
TM Helix Prediction | (7-24) signal sequence |
DisProt Annotation | |
Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
spP31725S10A9_MOUSE_Prot is 113 residues long, with 80 residues (70.80 %) predicted as disordered. The protein has 1 short (< 30 residues) disorder segment and 1 long (>= 30 residues) disorder segment.
Segment 1 - Long (>= 30 residues) disordered segment
Segment is located between positions 1 and 51 in the sequence.
The segment is 51 residues long (45.13 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment
Segment is located between positions 85 and 113 in the sequence.
The segment is 29 residues long (25.66 % of the total sequence length). |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | binds toToll-like receptor four TLR4, amplifies inflammation |
References for function | Harman JL, Loes AN, Warren GD, Heaphy MC, Lampi KJ, Harms MJ. Evolution of multifunctionality through a pleiotropic substitution in the innate immune protein S100A9. Elife. 2020 Apr 7;9:e54100. doi: 10.7554/eLife.54100. PMID: 32255429; PMCID: PMC7213983. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | |
Comments | |
Function 2 |
Function description | part of a heterocomplex with S100A8 to drive inflammation, antimicrobial |
References for function | Harman JL, Loes AN, Warren GD, Heaphy MC, Lampi KJ, Harms MJ. Evolution of multifunctionality through a pleiotropic substitution in the innate immune protein S100A9. Elife. 2020 Apr 7;9:e54100. doi: 10.7554/eLife.54100. PMID: 32255429; PMCID: PMC7213983. |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | |
Comments | |