| General Information |
| MoonProt ID | 50 |
| First appeared in release | 1.0 |
| Name(s) | GAPDH
Glyceraldehyde-3-phosphate dehydrogenase
Gene Name: gap
|
| UniProt ID | P52987 (G3P_LACLA), Reviewed |
| GO terms | GO:0006006 glucose metabolic process
GO:0006096 glycolysis
GO:0055114 oxidation-reduction process
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Lactococcus lactis IL1403 (Gram positive bacterium) |
| Sequence length | 337 |
| FASTA sequence | >sp|P52987|G3P_LACLA Glyceraldehyde-3-phosphate dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gap PE=3 SV=2
MVVKVGINGFGRIGRLALRRIQEVEGVEVAHINDLTDPAMLAHLLKYDTTQGRFKGTVEVKEDGFDVNGKFVKVTAERNPEDIQWADSGVEIVLEATGFFATKEKAEKHLHPGGAKKVLITAPGGNDVKTVVFNTNHTILDGTETVISAGSCTTNSLAPMADALNKNFGVKGGTMTTVHSYTGDQMTLDGPHRGGDFRRARAAAENIVPASSGAAKAIGLVLPELSGLMKGHAQRVSTPTGSITELVTVLEKHVTVDEINEAMKAAADESFGYNVDEIVSSDIIGMAYGSLFDATLTEVTDLKDGGQLVKTAAWYDNEMSFTAQLIRTLEYFAKIAK
|
| Structure Information |
| PDB ID | closest is Streptococcus at 74% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-2), middle regions (aa 182-196), and C terminus (aa 336-337) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | glyceraldehyde 3-phosphate dehydrogenase, GAPDH, enzyme
D-glyceraldehyde 3-phosphate + phosphate + NAD+ = 1,3-bisphospho-D-glycerate + NADH.
Carbohydrate degradation, glycolysis |
| References for function | |
| E.C. number | 1.2.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binding to invertase, a hyperglycosylated mannoprotein from Saccharomyces cerevisiae |
| References for function | Katakura Y, Sano R, Hashimoto T, Ninomiya K, Shioya S. 2010. Lactic acid bacteria display on the cell surface cytosolic proteins that recognize yeast mannan. Appl Microbiol Biotechnol. 2010 Mar;86(1):319-26. doi: 10.1007/s00253-009-2295-y. Epub 2009 Nov 7. PMID:
19898842 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |