| General Information |
| MoonProt ID | 501 |
| First appeared in release | 3.0 |
| Name(s) | Splicing factor 3A subunit 2
Gene
SF3A2 |
| UniProt ID | Q15428 (SF3A2_HUMAN) |
| GO terms | GO:0000245 spliceosomal complex assembly
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0006397 mRNA processing
GO:0008270 zinc ion binding
GO:0008380 RNA splicing
GO:0010976 positive regulation of neuron projection development
GO:0016607 nuclear speck
GO:0046872 metal ion binding
GO:0071004 U2-type prespliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:1903241 U2-type prespliceosome assembly
|
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 464 amino acids |
| FASTA sequence | >sp|Q15428|SF3A2_HUMAN Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2
MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL
TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVT
KQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIA
FKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASG
VHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPP
APGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPG
VHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN |
| Structure Information |
| PDB ID | 5Z56 |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-29), middle region (aa 72-98, 120-121), and C terminus (aa 210-464) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | pre-mRNA splicing, a component of the splicing factor SF3A complex |
| References for function | 11533230 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm, spliceosome |
| Comments | NA |
| Function 2 |
| Function description | binds Ndc80/HEC1, without it see Morphologically irregular spindles; defective chromosome congression at metaphase |
| References for function | 30475206 15142036 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | mitotic spindle |
| Comments | NA |