| General Information |
| MoonProt ID | 503 |
| First appeared in release | 3.0 |
| Name(s) | LD47455p
Gene
Sf3a2 |
| UniProt ID | Q9VU15 (Q9VU15_DROME) |
| GO terms | GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0006397 mRNA processing
GO:0008270 zinc ion binding
GO:0008380 RNA splicing
GO:0010628 positive regulation of gene expression
GO:0071004 U2-type prespliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
|
| Organisms for which functions have been demonstrated | Drosophila melanogaster (fruit fly, an insect) |
| Sequence length | 264 amino acids |
| FASTA sequence | >tr|Q9VU15|Q9VU15_DROME LD47455p OS=Drosophila melanogaster OX=7227 GN=Sf3a2 PE=1 SV=1
MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL
TLHNNEGSYLAHTQGKKHQDNLARRAAKEAKEAPSSLLAPEKPRVEPKKFVKIGRPGYRV
TKQRELSNGQQSLLFQVDYPEITESIVPRHRFMSAYEQKIEPPDRKWQYLLFAAEPYETI
GFKVPSREVEKSEGKFWTHWNRDTKQFFLQFAFKFEPKILPPPPPNLHRALGPPGGFPMP
GPPRPAMHPMFNGVHPPPPMLSNN |
| Structure Information |
| PDB ID | closest is human at 82%amino acid sequence identity |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-23), middle region (aa 73-109), and C terminus (aa 223-264) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of spliceosome |
| References for function | 18981222 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | cytoplasm, spliceosome |
| Comments | NA |
| Function 2 |
| Function description | binds Ndc80, Mitch, and Nuf2 (Ndc80 complex) without it see Reduced accumulation of Ndc80 at kinetochores and severe defects in chromosome alignment |
| References for function | 30475206 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | mitotic spindle |
| Comments | NA |