| General Information |
| MoonProt ID | 505 |
| First appeared in release | 3.0 |
| Name(s) | Citrate synthase CitA |
| UniProt ID | A0A0H3C985_CAUVN unreviewed |
| GO terms | GO:0006099 tricarboxylic acid cycle
GO:0016740 transferase activity
GO:0016746 transferase activity, transferring acyl groups |
| Organisms for which functions have been demonstrated | Caulobacter vibrioides (strain NA1000 / CB15N) (Caulobacter crescentus) |
| Sequence length | 426 amino acids |
| FASTA sequence | >tr|A0A0H3C985|A0A0H3C985_CAUVN Citrate synthase OS=Caulobacter vibrioides (strain NA1000 / CB15N) OX=565050 GN=CCNA_01983 PE=3 SV=1
MTDKATLTIGDKSYELPILKGSTGPDVIDVRKIYGESDHFTFDPGFTSTASCESKITYID
GDAGILLHRGYPIDQLAEKSSFLEVCYLLLNGELPKADEFAKFEHNITYHTMLHAQFDRF
FEGFRRDAHPMAVMTGAVGALSAFYSDSINVDDAREREISAHRLIAKMPTIAARAYKYTVGQPFVSPRNDLSYSENFLRMCFAVPAEDWKPNPVLTRAMDRIFILHADHEQNASTSTVRLAGSSGAHPFACIAAGIACLWGPSHGGANQEALEMLETIGSVDNIKDYVQGVKDRKYKLMGFGHRVYKNFDPRAKVMQKTAHEVLAELGHNNDPLLQVAQELEKVALNDPYFVDRKLYPNIDFYSGITLRAMGFPTNMFTVLFALARTVGWISQWKEMFEDPTRKIGRPRQLYTGATHRDYVTLDKR |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices
# tr|A0A0H3C985|A0A0H3C985_CAUVN Number of predicted TMHs: 0
# tr|A0A0H3C985|A0A0H3C985_CAUVN Exp number of AAs in TMHs: 7.10364
# tr|A0A0H3C985|A0A0H3C985_CAUVN Exp number, first 60 AAs: 0
# tr|A0A0H3C985|A0A0H3C985_CAUVN Total prob of N-in: 0.03445
tr|A0A0H3C985|A0A0H3C985_CAUVN TMHMM2.0 outside 1 426 |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-7), and C terminus (aa 419-426) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | citrate synthase |
| References for function | Bergé M, Pezzatti J, González-Ruiz V, Degeorges L, Mottet-Osman G, Rudaz S, Viollier PH. Bacterial cell cycle control by citrate synthase independent of enzymatic activity. Elife. 2020 Mar 9;9:e52272. doi: 10.7554/eLife.52272. PMID: 32149608; PMCID: PMC7083601. |
| E.C. number | 2.3.3.16 |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |
| Function 2 |
| Function description | cell cycle control (enzyme function not needed) |
| References for function | Bergé M, Pezzatti J, González-Ruiz V, Degeorges L, Mottet-Osman G, Rudaz S, Viollier PH. Bacterial cell cycle control by citrate synthase independent of enzymatic activity. Elife. 2020 Mar 9;9:e52272. doi: 10.7554/eLife.52272. PMID: 32149608; PMCID: PMC7083601. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |