| General Information |
| MoonProt ID | 506 |
| First appeared in release | 3.0 |
| Name(s) | Fibroblast growth factor 2
Gene: FGF2 Synonyms: FGFB
Recommended name:
Fibroblast growth factor 2
Short name:
FGF-2
Alternative name(s):
Basic fibroblast growth factor
Short name:
bFGF
Heparin-binding growth factor 2
Short name:
HBGF-2 |
| UniProt ID | P09038 (FGF2_HUMAN) |
| GO terms | GO:1903672 positive regulation of sprouting angiogenesis
GO:0030154 cell differentiation
GO:0051781 positive regulation of cell division
GO:0005576 extracellular region
GO:0001525 angiogenesis
GO:0005634 nucleus
GO:0008201 heparin binding
GO:0007275 multicellular organism development
GO:0008083 growth factor activity
GO:0005178 integrin binding
GO:0042060 wound healing
GO:0043406 positive regulation of MAP kinase activity
GO:0090050 positive regulation of cell migration involved in sprouting angiogenesis
GO:0043536 positive regulation of blood vessel endothelial cell migration
GO:0030374 nuclear receptor transcription coactivator activity
GO:0005515 protein binding
GO:2000544 regulation of endothelial cell chemotaxis to fibroblast growth factor
GO:0060548 negative regulation of cell death
GO:0045893 positive regulation of transcription, DNA-templated
GO:0030214 hyaluronan catabolic process
GO:0010764 negative regulation of fibroblast migration
GO:0008543 fibroblast growth factor receptor signaling pathway
GO:2000573 positive regulation of DNA biosynthetic process
GO:1903672 positive regulation of sprouting angiogenesis
GO:0045766 positive regulation of angiogenesis
GO:0045766 positive regulation of angiogenesis
GO:2001028 positive regulation of endothelial cell chemotaxis
GO:1902748 positive regulation of lens fiber cell differentiation
GO:2000546 positive regulation of endothelial cell chemotaxis to fibroblast growth factor
GO:0001938 positive regulation of endothelial cell proliferation
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0061045 negative regulation of wound healing
GO:0060591 chondroblast differentiation
GO:0008543 fibroblast growth factor receptor signaling pathway
GO:0001658 branching involved in ureteric bud morphogenesis |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 288 amino acids |
| FASTA sequence | >sp|P09038|FGF2_HUMAN Fibroblast growth factor 2 OS=Homo sapiens OX=9606 GN=FGF2 PE=1 SV=3
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Structure Information |
| PDB ID | 1BAS
1BFB
1BFC
1BFF
1BFG
1BLA
1BLD
1CVS
1EV2
1FGA
1FQ9
1II4
1IIL
2BFH
2FGF
2M49
4FGF
4OEE
4OEF
4OEG
5X1O
6L4O |
| Quaternary structure | NA |
| SCOP | 1 domain.
class 1000001 All beta proteins
fold 2000422 beta-Trefoil
superfamily 3000648 Cytokine
family 4001987 Fibroblast growth factors (FGF)
domain 8029620 This domain is represented by 4FGF A:20-143 Fibroblast growth factor 2. Species Homo sapiens. |
| CATH | 1 Matching CATH Superfamily.
Superfamily: 2.80.10.50. CATH superfamily 2.80.10.50.
1 Matching CATH Domain.
Domain: 1basA00 PDB code 1bas, chain A, domain 00 Superfamily: 2.80.10.50. |
| TM Helix Prediction | no TM helices
# sp|P09038|FGF2_HUMAN Number of predicted TMHs: 0
# sp|P09038|FGF2_HUMAN Exp number of AAs in TMHs: 0.00107
# sp|P09038|FGF2_HUMAN Exp number, first 60 AAs: 0.00088
# sp|P09038|FGF2_HUMAN Total prob of N-in: 0.00801
sp|P09038|FGF2_HUMAN TMHMM2.0 outside 1 288 |
| DisProt Annotation | DisProt ID: DP01644
UniProt Accession: P09038
Protein Name: Fibroblast growth factor 2
Organism: Homo sapiens
Disorder content: 0.0764 |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
spP09038FGF2_HUMAN_Fibro is 288 residues long, with 138 residues (47.92 %) predicted as disordered. The protein has 1 short (< 30 residues) disorder segment and 1 long (>= 30 residues) disorder segment.
Segment 1 - Short (< 30 residues) disordered segment
Segment is located between positions 1 and 20 in the sequence.
The segment is 20 residues long (6.94 % of the total sequence length).
Segment 2 - Long (>= 30 residues) disordered segment
Segment is located between positions 34 and 151 in the sequence.
The segment is 118 residues long (40.97 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | 134920 |
| Function 1 |
| Function description | fibroblast growth factor, binds receptor |
| References for function | Shimoyama Y, Gotoh M, Ino Y, Sakamoto M, Kato K, Hirohashi S. Characterization of high-molecular-mass forms of basic fibroblast growth factor produced by hepatocellular carcinoma cells: possible involvement of basic fibroblast growth factor in hepatocarcinogenesis. Jpn J Cancer Res. 1991 Nov;82(11):1263-70. doi: 10.1111/j.1349-7006.1991.tb01791.x. PMID: 1721615; PMCID: PMC5918314. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | extracellular, secreted |
| Comments | |
| Function 2 |
| Function description | mediates phosphorylation of ERK1/2 |
| References for function | Zhao G, Bailey CG, Feng Y, Rasko J, Lovicu FJ. Negative regulation of lens fiber cell differentiation by RTK antagonists Spry and Spred. Exp Eye Res. 2018 May;170:148-159. doi: 10.1016/j.exer.2018.02.025. Epub 2018 Mar 1. PMID: 29501879; PMCID: PMC5924633. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | extracellular |
| Comments | |