General Information |
MoonProt ID | 51 |
First appeared in release | 1.0 |
Name(s) | GAPDH
Glyceraldehyde-3-phosphate dehydrogenase
Gene Name: GPD
|
UniProt ID | Q8X1X3 (G3P_PARBA), Reviewed |
GO terms | GO:0006006 glucose metabolic process
GO:0006096 glycolysis
GO:0055114 oxidation-reduction process
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:0005737 cytoplasm |
Organisms for which functions have been demonstrated | Paracoccidioides brasiliensis |
Sequence length | 338 |
FASTA sequence | >gi|30995493|gb|AAP42760.1| glyceraldehyde-3-phosphate dehydrogenase [Paracoccidioides brasiliensis]
MVVKVGINGFGRIGRIVFRNAVEHDDVEIVAVNDPFIETKYAAYMLKYDSTHGQFKGDIQHSSSNNLTVNNKTIHFYQERDPANIPWGKHGVDYVVESTGVFTTTEKAKAHLSGGAKKVIISAPSADAPMFVMGVNEKSYRPDISVLSNASCTTNCLAPLAKVIHDNFGIAEGLMTTIHSYTATQKTVDGPSHKDWRGGRTAAQNIIPSSTGAAKAVGKVIPALNGKLTGMAMRVPTANVSVVDLTCRTEKPVTYDQIKAAVKAASEGELKGILGYSEDALVSTDLNGDPRSSIFDASAGIALNDRFVKLISWYDNEWGYSRRVLDLIAYIAKVDAGK |
Structure Information |
PDB ID | closest is Bos taurus at 72% amino acid sequence identity |
Quaternary structure | |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-2,333-338 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | glyceraldehyde 3-phosphate dehydrogenase, enzyme
D-glyceraldehyde 3-phosphate + phosphate + NAD+ = 1,3-bisphosphoglycerate + NADH.
Carbohydrate degradation, glycolysis |
References for function | |
E.C. number | 1.2.1.12 |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | bind to fibronectin, laminin, and type I collagen |
References for function | Sj?str?m I, Grndahl H, Falk G, Kronvall G, Ullberg M. Purification and characterisation of a plasminogen-binding protein from Haemophilus influenzae. Sequence determination reveals identity with aspartase. Biochim Biophys Acta. 1997 Mar 13;1324(2):182-90. PMID: 9092705 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cell surface |
Comments | |