| General Information |
| MoonProt ID | 516 |
| First appeared in release | 4.0 |
| Name(s) | Candida tropicalis (Yeast) |
| UniProt ID | Q02216 |
| GO terms | "GO:0003824 catalytic activity
GO:0004474 malate synthase activity
GO:0004474 malate synthase activity
GO:0006097 glyoxylate cycle
GO:0006099 tricarboxylic acid cycle
GO:0005737 cytoplasm
GO:0005777 peroxisome
GO:0005782 peroxisomal matrix
GO:0009514 glyoxysome" |
| Organisms for which functions have been demonstrated | Candida tropicalis (Yeast) |
| Sequence length | 551 amino acids |
| FASTA sequence | ">sp|Q02216|MASY_CANTR Malate synthase, glyoxysomal OS=Candida tropicalis OX=5482 GN=PMS1 PE=3 SV=1
MSTPFPKTADKVKGVQILGPIPDEAKHIFNQETLAFVATLHRGFEARRQELLNNRKEQQK
LRDQGFLPDFLPETEYIRNDSTWTGPALAPGLIDRRCEITGPTDRKMVINALNSNVATYM
ADFEDSLTPAWKNLVEGQVNLYDAVRRNLSATINGKQYNLNLEKGRHIPTLIVRPRGWHL
TEKHVLVDGTPVSGGIFDFAVYFYNSAKEAIAQGFGPYFYLPKMEHHLEAKLWNDIFNYS
QDYIGLKRGTIRASVLIETIPAVFQMDEIIYQLREHSAGLNCGRWDYIFSYIKCLRNHPD
FILPDRSQVTMAAPFMSSYVKLLVHTTHKRKVHALGGMAAQIPIKDDEARNRAALENVTK
DKLREVTLGCDSCWVAHPALVPVVLKVFNEHMKGPNQISLPPKEPFKPITQRDLLSPFVP
GAKITEQGIRANIVIGISYIEAWLRNVGCVPINYLMEDAATAEVSRTQIWQWVTHGAKTD
TGKVITKEYVKQLLDEEYAKLTKNAKPGNKFKRAFEYFAPEALGEKYSDFVTTLIYDDVT
TIGRALPGERL" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, malate synthase |
| References for function | Kozik A, Karkowska-Kuleta J, Zajac D, Bochenska O, Kedracka-Krok S, Jankowska U, Rapala-Kozik M. Fibronectin-, vitronectin- and laminin-binding proteins at the cell walls of Candida parapsilosis and Candida tropicalis pathogenic yeasts. BMC Microbiol. 2015 Oct 5;15:197. doi: 10.1186/s12866-015-0531-4. PMID: 26438063; PMCID: PMC4595241. |
| E.C. number | EC:2.3.3.9 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds fibronectin, binds vitronectin, binds laminin |
| References for function | Kozik A, Karkowska-Kuleta J, Zajac D, Bochenska O, Kedracka-Krok S, Jankowska U, Rapala-Kozik M. Fibronectin-, vitronectin- and laminin-binding proteins at the cell walls of Candida parapsilosis and Candida tropicalis pathogenic yeasts. BMC Microbiol. 2015 Oct 5;15:197. doi: 10.1186/s12866-015-0531-4. PMID: 26438063; PMCID: PMC4595241. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell wall |
| Comments | |