| General Information |
| MoonProt ID | 517 |
| First appeared in release | 4.0 |
| Name(s) | Candida tropicalis (Yeast) |
| UniProt ID | P07820 |
| GO terms | "GO:0004096 catalase activity
GO:0004601 peroxidase activity
GO:0016491 oxidoreductase activity
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:0000302 response to reactive oxygen species
GO:0006979 response to oxidative stress
GO:0042542 response to hydrogen peroxide
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005777 peroxisome
GO:0005782 peroxisomal matrix" |
| Organisms for which functions have been demonstrated | Candida tropicalis (Yeast) |
| Sequence length | 485 amino acids |
| FASTA sequence | ">sp|P07820|CATA_CANTR Peroxisomal catalase OS=Candida tropicalis OX=5482 GN=POX9 PE=1 SV=4
MAPTFTNSNGQPIPEPFATQRVGQHGPLLLQDFNLIDSLAHFDRERIPERVVHAKGSGAY
GVFEVTDDITDVCAAKFLDTVGKKTRIFTRFSTVGGELGSADTARDPRGFATKFYTEEGN
LDLVYNNTPVFFIRDPSKFPHFIHTQKRNPETHLKDANMFWDYLTTNEESVHQVMVLFSD
RGTPASYREMNGYSGHTYKWSNNKGEWFYVQVHFISDQGIKTLTNEEAGSLAGSNPDYAQ
EDLFKNIAAGNYPSWTCYIQTMTEAQAKEAEFSVFDLTKVWPHGKYPMRRFGKFTLNENP
KNYFAEVEQAAFSPAHTVPHMEPSADPVLQSRLFSYADTHRHRLGTNYTQIPVNCPVTGA
VFNPHMRDGAMNVNGNLGNHPNYLASDKPIEFKQFSLQEDQEVWHGAATPFHWKATPADF
KQATELWKVLKKYPNQQEHLAHNVAVHASAADAPIQDRVIAYFTKVHPDLGDLIKKEILE
LSPRK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, catalase |
| References for function | Kozik A, Karkowska-Kuleta J, Zajac D, Bochenska O, Kedracka-Krok S, Jankowska U, Rapala-Kozik M. Fibronectin-, vitronectin- and laminin-binding proteins at the cell walls of Candida parapsilosis and Candida tropicalis pathogenic yeasts. BMC Microbiol. 2015 Oct 5;15:197. doi: 10.1186/s12866-015-0531-4. PMID: 26438063; PMCID: PMC4595241. |
| E.C. number | EC:1.11.1.6 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds laminin, binds vitronectin |
| References for function | Kozik A, Karkowska-Kuleta J, Zajac D, Bochenska O, Kedracka-Krok S, Jankowska U, Rapala-Kozik M. Fibronectin-, vitronectin- and laminin-binding proteins at the cell walls of Candida parapsilosis and Candida tropicalis pathogenic yeasts. BMC Microbiol. 2015 Oct 5;15:197. doi: 10.1186/s12866-015-0531-4. PMID: 26438063; PMCID: PMC4595241. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell wall |
| Comments | |