Protein Information

General Information
MoonProt ID524
First appeared in release4.0
Name(s)Anas laysanensis (Laysan duck) (Anas platyrhynchos laysanensis)
UniProt IDT2B2T5 
GO termsGO:0000287 magnesium ion binding, GO:0004634 phosphopyruvate hydratase activity, GO:0016829 lyase activity, GO:0046872 metal ion binding, GO:0006096 glycolytic process, GO:0005737 cytoplasm, GO:0000015 phosphopyruvate hydratase complex
Organisms for which functions have been demonstratedAnas laysanensis (Laysan duck) (Anas platyrhynchos laysanensis)
Sequence length399
FASTA sequence>tr|T2B2T5|T2B2T5_ANALA phosphopyruvate hydratase (Fragment) OS=Anas laysanensis OX=75850 GN=ENO1 PE=3 SV=1 DFKSPDDPSRYISPDQLADLYKGFVKNYPVVSIEDPFDQ
Structure Information
PDB IDNA
Quaternary structureNA
SCOP
CATH
TM Helix Predictionno TM helices
DisProt Annotation
Predicted Disorder Regions
Connections to Disease
OMIM ID
Function 1
Function descriptionenzyme, enolase, 2-phospho-D-glycerate => phosphoenolpyruvate + H2O Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. Carbohydrate degradation, glycolysis
References for functionWistow GJ, Lietman T, Williams LA, Stapel SO, de Jong WW, Horwitz J, Piatigorsky J. Tau-crystallin/alpha-enolase: one gene encodes both an enzyme and a lens structural protein. J Cell Biol. 1988 Dec;107(6 Pt 2):2729-36. doi: 10.1083/jcb.107.6.2729. PMID: 2462567; PMCID: PMC2115652.
E.C. numberEC:4.2.1.11
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptiontau-crystallin
References for functionWistow GJ, Lietman T, Williams LA, Stapel SO, de Jong WW, Horwitz J, Piatigorsky J. Tau-crystallin/alpha-enolase: one gene encodes both an enzyme and a lens structural protein. J Cell Biol. 1988 Dec;107(6 Pt 2):2729-36. doi: 10.1083/jcb.107.6.2729. PMID: 2462567; PMCID: PMC2115652.
E.C. number
Location of functional site(s)
Cellular location of function
Comments