| General Information |
| MoonProt ID | 527 |
| First appeared in release | 4.0 |
| Name(s) | Escherichia coli (strain K12) |
| UniProt ID | P63417 |
| GO terms | "GO:0005515 protein binding
GO:0016740 transferase activity
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0005829 cytosol" |
| Organisms for which functions have been demonstrated | Escherichia coli (strain K12) |
| Sequence length | 167.0 |
| FASTA sequence | >sp|P63417|YHBS_ECOLI Uncharacterized N-acetyltransferase YhbS OS=Escherichia coli (strain K12) OX=83333 GN=yhbS PE=3 SV=1 MLIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVAFS PVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYSRF GFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHEHFNRF |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-4), and C terminus (aa 163-167) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, acetyltransferase, catalyzes the transfer of acetyl groups from acetyl-coenzyme A to a substrate |
| References for function | Luo X, Zhang A, Tai CH, Chen J, Majdalani N, Storz G, Gottesman S. An acetyltranferase moonlights as a regulator of the RNA binding repertoire of the RNA chaperone Hfq in Escherichia coli. Proc Natl Acad Sci U S A. 2023 Dec 5;120(49):e2311509120. doi: 10.1073/pnas.2311509120. Epub 2023 Nov 27. Erratum in: Proc Natl Acad Sci U S A. 2025 Feb 25;122(8):e2501041122. doi: 10.1073/pnas.2501041122. PMID: 38011569; PMCID: PMC10710024. |
| E.C. number | 2.3.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | Direct regulator of Hfq |
| References for function | Luo X, Zhang A, Tai CH, Chen J, Majdalani N, Storz G, Gottesman S. An acetyltranferase moonlights as a regulator of the RNA binding repertoire of the RNA chaperone Hfq in Escherichia coli. Proc Natl Acad Sci U S A. 2023 Dec 5;120(49):e2311509120. doi: 10.1073/pnas.2311509120. Epub 2023 Nov 27. Erratum in: Proc Natl Acad Sci U S A. 2025 Feb 25;122(8):e2501041122. doi: 10.1073/pnas.2501041122. PMID: 38011569; PMCID: PMC10710024. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |