| General Information |
| MoonProt ID | 53 |
| First appeared in release | 1.0 |
| Name(s) | GAPDH
Glyceraldehyde-3-phosphate dehydrogenase
Plasmin receptor
Plasminogen-binding protein
gapA, plr
Gene Name: gap
|
| UniProt ID | P68777 (G3P_STRP8), Reviewed |
| GO terms | GO:0006006 glucose metabolic process
GO:0006096 glycolysis
GO:0055114 oxidation-reduction process
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Streptococcus pyogenes (Gram positive bacterium) |
| Sequence length | 336 |
| FASTA sequence | >sp|P68777|G3P_STRP8 Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gap PE=3 SV=2
MVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKEAAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFGYTEDPIVSSDIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK
|
| Structure Information |
| PDB ID | 6FZH |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.30.360.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1,333-336 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | glyceraldehyde 3-phosphate dehydrogenase, enzyme
D-glyceraldehyde 3-phosphate + phosphate + NAD+ => 1,3-bisphosphoglycerate + NADH.
Carbohydrate degradation, glycolysis |
| References for function | demonstrated enzyme activity: Pancholi V, Fischetti VA: A major surface protein on group A streptococci is a glyceraldehyde-3-phosphate-dehydrogenase with multiple binding activity. J Exp Med. 1992 Aug 1;176(2):415-26. |
| E.C. number | 1.2.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds uPAR/CD87 receptor on human cells |
| References for function | Jin H, Song YP, Boel G, Kochar J, Pancholi V. Group A streptococcal surface GAPDH, SDH, recognizes uPAR/CD87 as its receptor on the human pharyngeal cell and mediates bacterial adherence to host cells. J Mol Biol. 2005 Jul 1;350(1):27-41.
PMID: 15922359 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | comments |