| General Information |
| MoonProt ID | 530 |
| First appeared in release | 4.0 |
| Name(s) | Streptococcus pneumoniae (strain P1031). Gram positive bacterium that can cause acute sinusitis, otitis media, and diseases such pneumonia, bacteraemia, meningitis and sepsis. About 1.6 million people die every year because of pneumococcal infections, with almost 1 million of them are children. Major public health concern due to their increasing resistance to antibiotics. |
| UniProt ID | C1CJ89 |
| GO terms | GO:0003677 DNA binding, GO:0004518 nuclease activity, GO:0009381 excinuclease ABC activity, GO:0006281 DNA repair, GO:0006289 nucleotide-excision repair, GO:0006974 DNA damage response, GO:0009432 SOS response, GO:0005737 cytoplasm, GO:0009380 excinuclease repair complex |
| Organisms for which functions have been demonstrated | Streptococcus pneumoniae |
| Sequence length | 614 amino acids |
| FASTA sequence | ">sp|C1CJ89|UVRC_STRZP UvrABC system protein C OS=Streptococcus pneumoniae (strain P1031) OX=488223 GN=uvrC PE=3 SV=1
MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYFRGSHDTKTEALVSEI
VDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKITNERYPRLIITRQVKK
DGGLYFGPYPDVGAANEIKRLLDRIFPFRKCTNPPSKVCFYYHIGQCMAHTICKKDEAYF
KSMAQEVSDFLKGQDDKIIDDLKSKMAVAAQSMEFERAAEYRDLIQAIGTLRTKQRVMAK
DLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFNDPDEDFLTYVGQFYQEKSH
LVPNEVLIPQDIDEEAVKALVDSKILKPQRGEKKQLVNLAIKNARVSLEQKFNLLEKSVE
KTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMVVFVNGKPSKKDYRKYKIKTVV
GPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQVNIAKQVIQEELGLDIPIAGLQ
KNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDEVHRFAITFHRQLRSKNSFSSQLD
GIDGLGPKRKQNLMRHFKSLTKIKEASVDEIVEVGVPRVVAEAVQRKLNPQGEALPQVAE
ERVDYQTEGNHNEP" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | excinuclease ABC subunit C |
| References for function | Hirayama, S., Yasui, Y., Sasagawa, K., Domon, H., & Terao, Y. (2023). Pneumococcal proteins ClpC and UvrC as novel host plasminogen binding factors. Microbiology and immunology, 67(2), 99–104. https://doi.org/10.1111/1348-0421.13040 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |
| Function 2 |
| Function description | binds plasminogen |
| References for function | Hirayama, S., Yasui, Y., Sasagawa, K., Domon, H., & Terao, Y. (2023). Pneumococcal proteins ClpC and UvrC as novel host plasminogen binding factors. Microbiology and immunology, 67(2), 99–104. https://doi.org/10.1111/1348-0421.13040 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |