| General Information |
| MoonProt ID | 54 |
| First appeared in release | 1.0 |
| Name(s) | GAPDH
Glyceraldehyde-3-phosphate dehydrogenase |
| UniProt ID | Q3Y454 (Q3Y454_STRSU), Unreviewed |
| GO terms | GO:0006006 glucose metabolic process
GO:0055114 oxidation-reduction process
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding |
| Organisms for which functions have been demonstrated | Streptococcus suis (Gram positive bacterium) |
| Sequence length | 336 |
| FASTA sequence | >gi|73612170|gb|AAZ78247.1| glyceraldehyde-3-phosphate dehydrogenase [Streptococcus suis]
MVVKVGITGFERIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLLKYDTTQGRFDGTVEVKDGGFEVNGKFVKVSAERKPGNIDWATDGVDIVLEATGFFASKEKAEQHIHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALHDAFGVQKGLMTTIHGYTGDQMVLDGPHRGGDLRRARAAAANIVPNSTGAAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVATLDKKVTAEEVNAAMKAAATESFGYTEDQLVSSDIVGISFGSLFDATQTKVIEVDGEQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK |
| Structure Information |
| PDB ID | closest is Streptococcus at 9% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-3), and C terminus (aa 336) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | GAPDH, glyceraldehyde 3-phosphate dehydrogenase, enzyme |
| References for function | |
| E.C. number | 1.2.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | plasminogen binding |
| References for function | Jobin MC, Brassard J, Quessy S, Gottschalk M, Grenier D. Acquisition of host plasmin activity by the Swine pathogen Streptococcus suis serotype 2. Infect Immun. 2004 Jan;72(1):606-10. PMID: 14688145 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |