| General Information |
| MoonProt ID | 544 |
| First appeared in release | 4.0 |
| Name(s) | Homoserine dehydrogenase hom6 |
| UniProt ID | P31116 |
| GO terms | GO:0004412 homoserine dehydrogenase activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0050661 NADP binding
GO:0070403 NAD+ binding
GO:0006520 amino acid metabolic process
GO:0008652 amino acid biosynthetic process
GO:0009067 aspartate family amino acid biosynthetic process
GO:0009088 L-threonine biosynthetic process
GO:0009090 L-homoserine biosynthetic process
GO:0071265 L-methionine biosynthetic process
GO:0005634 nucleus
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae |
| Sequence length | 359 |
| FASTA sequence | >sp|P31116|DHOM_YEAST Homoserine dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOM6 PE=1 SV=1
MSTKVVNVAVIGAGVVGSAFLDQLLAMKSTITYNLVLLAEAERSLISKDFSPLNVGSDWK
AALAASTTKTLPLDDLIAHLKTSPKPVILVDNTSSAYIAGFYTKFVENGISIATPNKKAF
SSDLATWKALFSNKPTNGFVYHEATVGAGLPIISFLREIIQTGDEVEKIEGIFSGTLSYI
FNEFSTSQANDVKFSDVVKVAKKLGYTEPDPRDDLNGLDVARKVTIVGRISGVEVESPTS
FPVQSLIPKPLESVKSADEFLEKLSDYDKDLTQLKKEAATENKVLRFIGKVDVATKSVSV
GIEKYDYSHPFASLKGSDNVISIKTKRYTNPVVIQGAGAGAAVTAAGVLGDVIKIAQRL |
| Structure Information |
| PDB ID | 1EBF, 1EBU, 1Q7G, 1TVE |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, Catalyzes the conversion of L-aspartate-beta-semialdehyde (L-Asa) to L-homoserine (L-Hse) |
| References for function | Chik JK, Su XB, Klepin S, Raygoza J, Pillus L. Non-canonical chromatin-based functions for the threonine metabolic pathway. Sci Rep. 2024 Sep 30;14(1):22629. doi: 10.1038/s41598-024-72394-z. PMID: 39349514; PMCID: PMC11442984. |
| E.C. number | 1.1.1.3 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | involved in transcriptional silencing of DNA, catalytic activity not needed for this function |
| References for function | Chik JK, Su XB, Klepin S, Raygoza J, Pillus L. Non-canonical chromatin-based functions for the threonine metabolic pathway. Sci Rep. 2024 Sep 30;14(1):22629. doi: 10.1038/s41598-024-72394-z. PMID: 39349514; PMCID: PMC11442984. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |