| General Information |
| MoonProt ID | 550 |
| First appeared in release | 4.0 |
| Name(s) | Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112) (Lactobacillus reuteri), commensal bacterium that resides in the human gut, can cause infection in humans with compromised immune systems. Has probiotic activity. |
| UniProt ID | B2G6R2 |
| GO terms | GO:0000166 nucleotide binding, GO:0000287 magnesium ion binding, GO:0003746 translation elongation factor activity, GO:0003924 GTPase activity, GO:0005525 GTP binding, GO:0016787 hydrolase activity, GO:0046872 metal ion binding, GO:0006412 translation, GO:0006414 translational elongation, GO:0005737 cytoplasm, GO:0005829 cytosol |
| Organisms for which functions have been demonstrated | Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112) (Lactobacillus reuteri), commensal bacterium that resides in the human gut, can cause infection in humans with compromised immune systems. Has probiotic activity. |
| Sequence length | 396 amino acids |
| FASTA sequence | ">sp|B2G6R2|EFTU_LIMRJ Elongation factor Tu OS=Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112) OX=557433 GN=tuf PE=3 SV=1
MAEKEHYERTKPHVNIGTIGHVDHGKTTLTAAITKVLAAKGLAKAEDYADIDAAPEEKER
GITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREH
ILLARQVGVQYIVVFLNKTDLVDDDELVDLVEMEVRDLLSEYDFPGDDVPVVRGSALKAL
EGDPEQEKVILHLMDVIDDYIPTPKRPTDKPFMMPVEDVFTITGRGTVASGRIDRGTVKV
GDEVEIVGLTEDVLKSTVTGLEMFHKTLDLGEAGDNVGVLLRGISHDQIQRGQVLAEPGS
IQTHKNFKGEVYVMTKEEGGRHTPFFSNYRPQFYFHTTDVTGTIELPDGVEMVMPGDNVT
FTVNLQKPVALEKGLKFTIREGGHTVGAGVVSDILD" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | elongation factor in protein biosynthesis |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds fibronectin |
| References for function | Nishiyama K, Ochiai A, Tsubokawa D, Ishihara K, Yamamoto Y, Mukai T. Identification and characterization of sulfated carbohydrate-binding protein from Lactobacillus reuteri. PLoS One. 2013 Dec 31;8(12):e83703. doi: 10.1371/journal.pone.0083703. Erratum in: PLoS One. 2017 Mar 14;12(3):e0174257. doi: 10.1371/journal.pone.0174257. PMID: 24391811; PMCID: PMC3877078. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |