| General Information |
| MoonProt ID | 57 |
| First appeared in release | 1.0 |
| Name(s) | GAPDH
glyceraldehyde 3-phosphate dehydrogenase
Gene Name: gap |
| UniProt ID | A0A0H2US80 |
| GO terms | GO:0006006 glucose metabolic process
GO:0055114 oxidation-reduction process
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding |
| Organisms for which functions have been demonstrated | Streptococcus pneumoniae (Gram positive bacterium) |
| Sequence length | 335 aa |
| FASTA sequence | >tr|A0A0H2US80|A0A0H2US80_STRPN Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gap PE=1 SV=1
MVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGKFIKVSAERDPEQIDWATDGVEIVLEATGFFAKKEAAEKHLKGGAKKVVITAPGGNDVKTVVFNTNHDVLDGTETVISGASCTTNCLAPMAKALQDNFGVVEGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGSAQRVPTPTGSVTELVAVLEKNVTVDEVNAAMKAASNESYGYTEDPIVSSDIVGMSYGSLFDATQTKVLDVDGKQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK
|
| Structure Information |
| PDB ID | 5M6D |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.30.360.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1, 333-335 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | glyceraldehyde 3-phosphate dehydrogenase, enzyme |
| References for function | |
| E.C. number | 1.2.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | plasminogen binding |
| References for function | Bergmann, S., M. Rohde, and S. Hammerschmidt. (2004) Glyceraldehyde-3-phosphate dehydrogenase of Streptococcus pneumoniae is a surface-displayed plasminogen-binding protein. Infect Immun. 2004 Apr;72(4):2416-9.
PMID: 15039372.
Pancholi, V., and Fischetti, V.A. (1992) A major surface protein on group A streptococci is a glyceraldehyde-3-phosphate dehydrogenase with multiple binding activity. J Exp Med. 1992 Aug 1;176(2):415-26.
PMID: 1500854 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |