| General Information |
| MoonProt ID | 571 |
| First appeared in release | 4.0 |
| Name(s) | Glutathione S-transferase |
| UniProt ID | A0A0K1TQN0 |
| GO terms | GO:0004364 glutathione transferase activity
GO:0016740 transferase activity |
| Organisms for which functions have been demonstrated | Sus scrofa (Pig) |
| Sequence length | 234 |
| FASTA sequence | >tr|A0A0K1TQN0|A0A0K1TQN0_PIG Glutathione S-transferase OS=Sus scrofa OX=9823 GN=GSTA2 PE=2 SV=1
MAGKPILHYFNGRGRMECIRWLLAAAGVEFEEKFIKTPEDLDKLTNDGSLLFQQVPMVEI
DGMKLVQTRAILNYIATKYNLYGKDAKERALMDMYTEGVADLGEMILLLPLRPPDEQDAE
VASIKEKSTNRYLPAFEKVLKSHGQDYLVGNKLSRADIQLVELLYCLEELDPSLLANFPL
LKALKTRVSNLPTVKKFLQPGSQRKPPMDEKCLEETKEGFQVLIRQAGPPRTLF |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | not in Disprot |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-4), middle regions (aa 119-124, 197-214), and C terminus (aa 223-234) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glutathione S-transferase |
| References for function | "Fedulova, N., Raffalli-Mathieu, F., and Mannervik, B. (2010). Porcine Glutathione
Transferase Alpha 2-2 Is a Human GST A3-3 Analogue that Catalyses Steroid
Double-Bond Isomerization. Biochem. J. 431 (1), 159–167. doi:10.1042/
BJ20100839" |
| E.C. number | 2.5.1.18 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | enzyme, steroid isomerase |
| References for function | "Fedulova, N., Raffalli-Mathieu, F., and Mannervik, B. (2010). Porcine Glutathione
Transferase Alpha 2-2 Is a Human GST A3-3 Analogue that Catalyses Steroid
Double-Bond Isomerization. Biochem. J. 431 (1), 159–167. doi:10.1042/
BJ20100839" |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |