| General Information |
| MoonProt ID | 575 |
| First appeared in release | 4.0 |
| Name(s) | alpha-enolase |
| UniProt ID | Q7NAY0 |
| GO terms | GO:0000287 magnesium ion binding
GO:0004634 phosphopyruvate hydratase activity
GO:0016829 lyase activity
GO:0046872 metal ion binding
GO:0006096 glycolytic process
GO:0007155 cell adhesion
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0000015 phosphopyruvate hydratase complex |
| Organisms for which functions have been demonstrated | Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2)) (Mycoplasma gallisepticum) |
| Sequence length | 475.0 |
| FASTA sequence | >sp|Q7NAY0|ENO_MYCGA Enolase OS=Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2)) OX=710127 GN=eno PE=1 SV=1
MAKTNSTSKNNKLEIKSVFAYQAFDSRGFPTVACEVVLNDGSKGLSMVSSGASTGEKEAL
ELRDGGTKYHGKGVTKAVNNINKKIGPKILGVDATLQTQIDEFMIELDGTKTKAKLGANA
ILAVSMAVCRAAAKSLNLPLYQYIAKKVAKVKGADFILPVPMLNVINGGAHADNTIDFQE
FMIMPVGAKTMAKALQMASEVFHSLQKLLKAKKFNTNKGDEGGFAPNLKSAEEALDLMSQ
AVVDAGYALGKDVAFALDCAASEFYSKEKQAYVFKKAVKAGILSEEKGTKTTEQLISYLE
DLTKKYPIVSIEDGLDENDWKGMESLTKKIGKKVQIVGDDTYCTNPELTSKGVSLSATNS
VLIKLNQIGTLTETIQTINIAKKANWTAVVSHRSGETEDAFIADLAVALSTGQIKTGSMS
RSERIAKYNRLLAIEMQLGNKAKYLGSKTFYNLSTPAATPKKSPAKKTTKAKSKK |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-8), middle regions (aa 59-62), and C terminus (aa 459-475) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, enolase, 2-phospho-D-glycerate => phosphoenolpyruvate + H2O Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. Carbohydrate degradation, glycolysis |
| References for function | Chen H, Yu S, Shen X, Chen D, Qiu X, Song C, Ding C. The Mycoplasma gallisepticum alpha-enolase is cell surface-exposed and mediates adherence by binding to chicken plasminogen. Microb Pathog. 2011 Oct;51(4):285-90. |
| E.C. number | EC:4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen, adhesin to chicken cells |
| References for function | Chen H, Yu S, Shen X, Chen D, Qiu X, Song C, Ding C. The Mycoplasma gallisepticum alpha-enolase is cell surface-exposed and mediates adherence by binding to chicken plasminogen. Microb Pathog. 2011 Oct;51(4):285-90. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |