| General Information |
| MoonProt ID | 580 |
| First appeared in release | 4.0 |
| Name(s) | Phosphoglucosamine mutase - glmM |
| UniProt ID | A6TEJ5 |
| GO terms | GO:0000287 magnesium ion binding, GO:0004615 phosphomannomutase activity, GO:0008966 phosphoglucosamine mutase activity, GO:0016853 isomerase activity, GO:0016868 intramolecular phosphotransferase activity, GO:0046872 metal ion binding, GO:0005975 carbohydrate metabolic process, GO:0006048 UDP-N-acetylglucosamine biosynthetic process, GO:0009252 peptidoglycan biosynthetic process, GO:0005829 cytosol |
| Organisms for which functions have been demonstrated | Klebsiella pneumoniae subsp. pneumoniae |
| Sequence length | 445.0 |
| FASTA sequence | >sp|A6TEJ5|GLMM_KLEP7 Phosphoglucosamine mutase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=glmM PE=3 SV=1
MSNRKYFGTDGIRGRVGDAPITPEFVLKLGWAAGKVLARHGSRKIIIGKDTRISGYMLES
ALEAGLAAAGLSASFTGPMPTPAIAYLTRAFRAEAGIVISASHNPFYDNGIKFFSIEGTK
LPDDVEEAIEAEMEKELTCVDSAELGKASRIVDAAGRYIEFCKGTFPNELSLGTLKVVVD
CAHGATYHIAPNVFRELGAQVIAMGCEPDGLNINEEVGATDVRALQARVLAEKADLGIAY
DGDGDRVIMVDHEGNKVDGDQILYIIAREGLRQGQLRGGAVGTLMSNMGLELALKQLGIP
FARAKVGDRYVLEMLQEKGWRIGAENSGHVILLDKTTTGDGIVASLQVVAAMVRNHMSLH
DLCSGMKMFPQLLVNVRFTEGSGNPLENEHVKAVTAEVEAALGKRGRVLLRKSGTEPLIR
VMVEGEHEDQVHEFAHRIAEAVKSV |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | not in DisProt |
| Predicted Disorder Regions | N-terminus AA 1-7, 439-445 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, phosphoglucomutase |
| References for function | Serek, P., Lewandowski, L., Dudek, B., Pietkiewicz, J., Jermakow, K., Kapczynska, K., Krzyzewska, E., & Bednarz-Misa, I. (2021). Klebsiella pneumoniae enolase-like membrane protein interacts with human plasminogen. International journal of medical microbiology : IJMM, 311(6), 151518. https://doi.org/10.1016/j.ijmm.2021.151518 |
| E.C. number | EC:5.4.2.10 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen |
| References for function | Serek, P., Lewandowski, L., Dudek, B., Pietkiewicz, J., Jermakow, K., Kapczynska, K., Krzyzewska, E., & Bednarz-Misa, I. (2021). Klebsiella pneumoniae enolase-like membrane protein interacts with human plasminogen. International journal of medical microbiology : IJMM, 311(6), 151518. https://doi.org/10.1016/j.ijmm.2021.151518 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |