| General Information |
| MoonProt ID | 583 |
| First appeared in release | 4.0 |
| Name(s) | DnaK |
| UniProt ID | A0A263HEQ3 |
| GO terms | GO:0000166 nucleotide binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0051082 unfolded protein binding
GO:0006457 protein folding |
| Organisms for which functions have been demonstrated | Actinobacillus seminis |
| Sequence length | 634.0 |
| FASTA sequence | >tr|A0A263HEQ3|A0A263HEQ3_9PAST Chaperone protein DnaK OS=Actinobacillus seminis OX=722 GN=dnaK PE=2 SV=1
MGKIIGIDLGTTNSCVAVMDGDKPRVIENAEGDRTTPSIIAYTNDNETLVGQPAKRQAVT
NPKNTLFAIKRLIGRRFEDQEVQRDVSIMPFEIVKADNGDAWVSVKGEKMAPPQISAEVL
KKMKKTAEDFLGETVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYG
LDKGKGNQTIAVYDLGGGTFDLSIIEIDEVGGEKTFEVLATNGDTHLGGEDFDNRVINYL
VDEFKKEQGVDLRNDPLAMQRLKEAGEKAKIELSSAQQTDVNLPYITADATGPKHLNIKL
TRAKLESLVEDLVARSMEPVKVALADAGLSVSDINDVILVGGQTRMPLVQQKVAEFFGKE
PRKDVNPDEAVAVGAAVQGGVLSGNVTDVLLLDVTPLSLGIETMGGVMTTLIEKNTTIPT
KKSQVFSTAEDNQSAVTIHVLQGERKQASANKSLGQFNLEGINPAPRGMPQIEVTFDIDA
DGIIHVSAKDKGTGKEQQITIKASSGLSDDEIQQMVRDAEANAEADRKFEELVQARNQAD
HLVHSTRKQLSEVGDKLSADDKAPIEKAVNELEAAAKGEDKAAIEEKLQALVQVSEKLIQ
VGQAQAQQGQQQAQQNPKDDGVVDAEFEEVKDNK |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-5), middle regions (aa 27-32, 52-56, 497-504, 512-521, 543-548, 554-555), and C terminus (aa 607-634) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Chaperone |
| References for function | Vazquez-Cruz C, Reyes-Malpica E, Montes-Garcia JF, Bautista-Betancourt P, Cobos-Justo E, Avalos-Rangel MA, Negrete-Abascal E. Actinobacillus seminis DnaK interacts with bovine transferrin, lactoferrin, and hemoglobin as a putative iron acquisition mechanism. Folia Microbiol (Praha). 2025 May 10. doi: 10.1007/s12223-025-01271-7. Epub ahead of print. PMID: 40348920. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds transferrin, lactoferrin, hemoglobin to help in iron acquisision |
| References for function | Vazquez-Cruz C, Reyes-Malpica E, Montes-Garcia JF, Bautista-Betancourt P, Cobos-Justo E, Avalos-Rangel MA, Negrete-Abascal E. Actinobacillus seminis DnaK interacts with bovine transferrin, lactoferrin, and hemoglobin as a putative iron acquisition mechanism. Folia Microbiol (Praha). 2025 May 10. doi: 10.1007/s12223-025-01271-7. Epub ahead of print. PMID: 40348920. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |