| General Information |
| MoonProt ID | 603 |
| First appeared in release | 4.0 |
| Name(s) | Glutamine synthetase |
| UniProt ID | P15104 |
| GO terms | GO:0000166 nucleotide binding
GO:0003824 catalytic activity
GO:0004356 glutamine synthetase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016740 transferase activity
GO:0016874 ligase activity
GO:0019706 protein-cysteine S-palmitoyltransferase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0001525 angiogenesis
GO:0006538 L-glutamate catabolic process
GO:0006542 obsolete glutamine biosynthetic process
GO:0008283 cell population proliferation
GO:0010594 regulation of endothelial cell migration
GO:0018345 protein palmitoylation
GO:0042254 ribosome biogenesis
GO:0045648 positive regulation of erythrocyte differentiation
GO:0097275 intracellular ammonium homeostasis
GO:1903670 regulation of sprouting angiogenesis
GO:1904749 regulation of protein localization to nucleolus
GO:0005737 cytoplasm
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0044297 cell body
GO:0070062 extracellular exosome
GO:0097386 glial cell projection |
| Organisms for which functions have been demonstrated | Homo sapiens |
| Sequence length | 373 |
| FASTA sequence | >sp|P15104|GLNA_HUMAN Glutamine synthetase OS=Homo sapiens OX=9606 GN=GLUL PE=1 SV=4
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW
NFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRI
MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY
RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCL
LNETGDEPFQYKN |
| Structure Information |
| PDB ID | 8DNU |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glutamate synthetase |
| References for function | Eelen G, Dubois C, Cantelmo AR, Goveia J, Brüning U, DeRan M, Jarugumilli G, van Rijssel J, Saladino G, Comitani F, Zecchin A, Rocha S, Chen R, Huang H, Vandekeere S, Kalucka J, Lange C, Morales-Rodriguez F, Cruys B, Treps L, Ramer L, Vinckier S, Brepoels K, Wyns S, Souffreau J, Schoonjans L, Lamers WH, Wu Y, Haustraete J, Hofkens J, Liekens S, Cubbon R, Ghesquière B, Dewerchin M, Gervasio FL, Li X, van Buul JD, Wu X, Carmeliet P. Role of glutamine synthetase in angiogenesis beyond glutamine synthesis. Nature. 2018 Sep;561(7721):63-69. doi: 10.1038/s41586-018-0466-7. Epub 2018 Aug 29. PMID: 30158707 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | enzyme, palmitoyltransferase |
| References for function | Eelen G, Dubois C, Cantelmo AR, Goveia J, Brüning U, DeRan M, Jarugumilli G, van Rijssel J, Saladino G, Comitani F, Zecchin A, Rocha S, Chen R, Huang H, Vandekeere S, Kalucka J, Lange C, Morales-Rodriguez F, Cruys B, Treps L, Ramer L, Vinckier S, Brepoels K, Wyns S, Souffreau J, Schoonjans L, Lamers WH, Wu Y, Haustraete J, Hofkens J, Liekens S, Cubbon R, Ghesquière B, Dewerchin M, Gervasio FL, Li X, van Buul JD, Wu X, Carmeliet P. Role of glutamine synthetase in angiogenesis beyond glutamine synthesis. Nature. 2018 Sep;561(7721):63-69. doi: 10.1038/s41586-018-0466-7. Epub 2018 Aug 29. PMID: 30158707 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |