General Information |
MoonProt ID | 62 |
First appeared in release | 1.0 |
Name(s) | GAPDH
glyceraldehyde 3-phosphate dehydrogenase
Gene Name: plr
|
UniProt ID | Q1J8I3 (Q1J8I3_STRPF) |
GO terms | GO:0006006 glucose metabolic process
GO:0055114 oxidation-reduction process
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding |
Organisms for which functions have been demonstrated | Streptococcus pyogenes serotype M4 (strain MGAS10750) (Gram positive bacterium) |
Sequence length | 336 |
FASTA sequence | >gi|76363879|sp|P0C0G6.2|G3P_STRPY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH; AltName: Full=Plasmin receptor; AltName: Full=Plasminogen-binding protein
MVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKEAAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINSAMKAASNDSFGYTEDPIVSSDIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK |
Structure Information |
PDB ID | 6ITE |
Quaternary structure | |
SCOP | NA |
CATH | 3.30.360.10 |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-7,333-336 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | glyceraldehyde 3-phosphate dehydrogenase, enzyme |
References for function | Winram SB, Lottenberg R: The plasmin-binding protein Plr of group A streptococci is identified as glyceraldehyde-3-phosphate dehydrogenase. Microbiology. 1996 Aug;142 ( Pt 8):2311-20. PMID: 8760943 |
E.C. number | 1.2.1.12 |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | Plasminogen binding |
References for function | Winram SB, Lottenberg R: The plasmin-binding protein Plr of group A streptococci is identified as glyceraldehyde-3-phosphate dehydrogenase. Microbiology. 1996 Aug;142 ( Pt 8):2311-20. PMID: 8760943 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cell surface |
Comments | |