| General Information |
| MoonProt ID | 622 |
| First appeared in release | 4.0 |
| Name(s) | Streptococcus pneumoniae |
| UniProt ID | A0A4J1YK73 |
| GO terms | GO:0000166 nucleotide binding, GO:0005524 ATP binding, GO:0008233 peptidase activity, GO:0016887 ATP hydrolysis activity, GO:0006508 proteolysis, GO:0034605 cellular response to heat, GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Streptococcus pneumoniae |
| Sequence length | 810 |
| FASTA sequence | ">tr|A0A4J1YK73|A0A4J1YK73_STREE ATP-dependent Clp protease, ATP-binding subunit OS=Streptococcus pneumoniae OX=1313 GN=clpC_2 PE=3 SV=1
MNYSKALNECIESAYMVAGHFGARYLESWHLLIAMSNHSYSVAGATLNDYPYEMDRLEEV
ALELTETDYSQDETFTELPFSRRLQILFDEAEYVASVVHAKVLGTEHVLYAILHDGNALA
TRILERAGFSYEDKKDQVKIAALRRNLEERAGWTREDLKALRQRHRTVADKQNSMANMMG
MPQTPSGGLEDYTHDLTEQARSGKLEPVIGRDKEISRMIQILSRKTKNNPVLVGDAGVGK
TALALGLAQRIASGDVPAEMAKMRVLELDLMNVVAGTRFRGDFEERMNNIIKDIEEDGQV
ILFIDELHTIMGSGSGIDSTLDAANILKPALARGTLRTVGATTQEEYQKHIEKDAALSRR
FAKVTIEEPSVADSMTILQGLKATYEKHHRVQITDEAVETAVKMAHRYLTSRHLPDSAID
LLDEAAATVQNKAKHVKADDSDLSPADKALMDGKWKQAAQLIAKEEEVPVYKDLVTESDI
LTTLSRLSGIPVQKLTQTDAKKYLNLEAELHKRVIGQDQAVSSISRAIRRNQSGIRSHKR
PIGSFMFLGPTGVGKTELAKALAEVLFDEESALIRFDMSEYMEKFAASRLNGAPPGYVGY
EEGGELTEKVRNKPYSVLLFDEVEKAHPDIFNVLLQVLDDGVLTDSKGRKVDFSNTIIIM
TSNLGATALRDDKTVGFGAKDIRFDQENMEKRMFEELKKAYRPEFINRIDEKVVFHSLSS
DHMQEVVKIMVKPLVASLAEKGIDLKLQASALKLLANQGYDPEMGARPLRRTLQTEVEDK
LAELLLKGDLVAGNTLKIGVKAGQLKFDIA" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helics |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ATP-dependent Clp protease ATP-binding subunit |
| References for function | Hirayama, S., Yasui, Y., Sasagawa, K., Domon, H., & Terao, Y. (2023). Pneumococcal proteins ClpC and UvrC as novel host plasminogen binding factors. Microbiology and immunology, 67(2), 99–104. https://doi.org/10.1111/1348-0421.13040 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |
| Function 2 |
| Function description | binds plasminogen |
| References for function | Hirayama, S., Yasui, Y., Sasagawa, K., Domon, H., & Terao, Y. (2023). Pneumococcal proteins ClpC and UvrC as novel host plasminogen binding factors. Microbiology and immunology, 67(2), 99–104. https://doi.org/10.1111/1348-0421.13040 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | surface of bacteria |
| Comments | "promote plasminogen activation by tissue type plasminogen activator. Bacteria recruits plasminogen to the bacterial surface and degrades the extracellular matrix of the host cells. Plasminogen bound is activated by tissue-type plasminogen activator (tPA) and urokinase-type plasminogen activator (uPA) to plasmin, which exhibits proteolytic activity.
preincubation of plasminogen with rClpC or rUvrC enchanced the activation of plasminogen by tPA depending on the amount of those recombinant proteins added.
ClpC is a heat shock protein that plays a multipart role in cell proliferation under heat stress. |