| General Information |
| MoonProt ID | 63 |
| First appeared in release | 1.0 |
| Name(s) | Glutamine synthetase
Gene Name: glnA
|
| UniProt ID | C2GUH0 (C2GUH0_BIFLN) |
| GO terms | GO:0006542 glutamine biosynthetic process
GO:0006807 nitrogen compound metabolic process
GO:0009399 nitrogen fixation
GO:0000166 nucleotide binding
GO:0003824 catalytic activity
GO:0004356 glutamate-ammonia ligase activity
GO:0005524 ATP binding
GO:0016874 ligase activity
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Bifidobacterium (Bifidobacterium lactis, B. bifidum, and B. longum) |
| Sequence length | 478 |
| FASTA sequence | >gi|494112847|ref|WP_007053626.1| glutamine synthetase [Bifidobacterium longum]
MTELKSKEDAEALINKEGIEYVSVRFTDLIGVQQHFTVPASEFLKDAFTDGMPFDGSSVQGFQAINESDMKLVPDVETSFVDPFRKHKTLDVAFSIVDPLTDEPYSRDPRQVAGKAEAYLKSTGIADTASFAPEAEFFIFDKVRFENSMQRSFYEVDSIEAPWNSGVDVEEDGTPNIGFKNRVKKGYFPVPPIDHTQDLRDDMVANLQKVGLILERSHHEVAGAGQQEINYRFNTLQHAGDDLMKYKYVVHETAALAGKAATFMPKPIADDNGTGMHCHQSLWKDGKPLFYDEKGYAGLSDLARWYIGGLIKHSSSVLAFTNPSLNSYHRLVPGFEAPVNLVYSARNRSAAIRIPLAGTSPAAKRIEFRAPDPSCNPFLAFSAQLMAGLDGILNHIEPPEPVDKDLYELPPEEHAGIKQVPSSLAEAMDALEEDHDFLTAGDVFTDDLIETWIGLKRDEIDQARLSPTPLEYELYFHI |
| Structure Information |
| PDB ID | closest is Bifidobacterium at 94% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-7), middle region (aa 401-423), and C terminus (aa 475-478) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Glutamine synthetase, enzyme
ATP + L-glutamate + NH3 => ADP + phosphate + L-glutamine |
| References for function | |
| E.C. number | 6.3.1.2 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | plasminogen binding |
| References for function | Candela M, et al. 2007. Binding of human plasminogen to Bifidobacterium. J Bacteriol. 2007 Aug;189(16):5929-36. Epub 2007 Jun 8. PMID: 17557824 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |