Protein Information

General Information
MoonProt ID630
First appeared in release4.0
Name(s)Homo sapiens
UniProt IDQ13526
GO terms" Gene Product GO Term UniProtKB:Q13526 GO:0046785 microtubule polymerization UniProtKB:Q13526 GO:0001934 positive regulation of protein phosphorylation UniProtKB:Q13526 GO:0032465 regulation of cytokinesis UniProtKB:Q13526 GO:0032465 regulation of cytokinesis UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity UniProtKB:Q13526 GO:0003755 peptidyl-prolyl cis-trans isomerase activity UniProtKB:Q13526 GO:0003774 cytoskeletal motor activity UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding Gene Product GO Term UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding Gene Product GO Term UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein bindingUniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0005515 protein binding UniProtKB:Q13526 GO:0008013 beta-catenin binding UniProtKB:Q13526 GO:0008013 beta-catenin binding UniProtKB:Q13526 GO:0008013 beta-catenin bindingUniProtKB:Q13526 GO:0016853 isomerase activity UniProtKB:Q13526 GO:0016859 cis-trans isomerase activity UniProtKB:Q13526 GO:0031434 mitogen-activated protein kinase kinase binding UniProtKB:Q13526 GO:0032794 GTPase activating protein binding UniProtKB:Q13526 GO:0048156 tau protein binding UniProtKB:Q13526 GO:0050815 phosphoserine residue binding UniProtKB:Q13526 GO:0050815 phosphoserine residue binding UniProtKB:Q13526 GO:0050816 phosphothreonine residue binding UniProtKB:Q13526 GO:0050816 phosphothreonine residue binding UniProtKB:Q13526 GO:0051219 phosphoprotein binding UniProtKB:Q13526 GO:0051219 phosphoprotein binding UniProtKB:Q13526 GO:1990757 ubiquitin ligase activator activity UniProtKB:Q13526 GO:0000413 protein peptidyl-prolyl isomerization UniProtKB:Q13526 GO:0001666 response to hypoxia UniProtKB:Q13526 GO:0006626 protein targeting to mitochondrion UniProtKB:Q13526 GO:0007088 regulation of mitotic nuclear division UniProtKB:Q13526 GO:0007266 Rho protein signal transduction UniProtKB:Q13526 GO:0010468 regulation of gene expression UniProtKB:Q13526 GO:0030182 neuron differentiation UniProtKB:Q13526 GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway UniProtKB:Q13526 GO:0031647 regulation of protein stability UniProtKB:Q13526 GO:0031648 protein destabilization UniProtKB:Q13526 GO:0032465 regulation of cytokinesis UniProtKB:Q13526 GO:0042177 negative regulation of protein catabolic process UniProtKB:Q13526 GO:0045944 positive regulation of transcription by RNA polymerase IIUniProtKB:Q13526 GO:0050808 synapse organization UniProtKB:Q13526 GO:0050821 protein stabilization UniProtKB:Q13526 GO:0050821 protein stabilization UniProtKB:Q13526 GO:0050821 protein stabilization UniProtKB:Q13526 GO:0060392 negative regulation of SMAD protein signal transduction UniProtKB:Q13526 GO:0060392 negative regulation of SMAD protein signal transduction UniProtKB:Q13526 GO:0070373 negative regulation of ERK1 and ERK2 cascade UniProtKB:Q13526 GO:0071456 cellular response to hypoxia UniProtKB:Q13526 GO:0090263 positive regulation of canonical Wnt signaling pathway UniProtKB:Q13526 GO:0090263 positive regulation of canonical Wnt signaling pathway UniProtKB:Q13526 GO:1900180 regulation of protein localization to nucleus UniProtKB:Q13526 GO:1902430 negative regulation of amyloid-beta formation UniProtKB:Q13526 GO:1902430 negative regulation of amyloid-beta formation UniProtKB:Q13526 GO:1902430 negative regulation of amyloid-beta formation UniProtKB:Q13526 GO:1903444 negative regulation of brown fat cell differentiation UniProtKB:Q13526 GO:2000146 negative regulation of cell motility UniProtKB:Q13526 GO:0005634 nucleus UniProtKB:Q13526 GO:0005829 cytosol UniProtKB:Q13526 GO:0098978 glutamatergic synapse UniProtKB:Q13526 GO:0098978 glutamatergic synapse UniProtKB:Q13526 GO:0098978 glutamatergic synapse UniProtKB:Q13526 GO:0098978 glutamatergic synapse UniProtKB:Q13526 GO:0098978 glutamatergic synapse UniProtKB:Q13526 GO:0099524 postsynaptic cytosol UniProtKB:Q13526 GO:0099524 postsynaptic cytosolUniProtKB:Q13526 GO:0099524 postsynaptic cytosol UniProtKB:Q13526 GO:0099524 postsynaptic cytosol UniProtKB:Q13526 GO:0099524 postsynaptic cytosol UniProtKB:Q13526 GO:0005634 nucleus UniProtKB:Q13526 GO:0005634 nucleus UniProtKB:Q13526 GO:0005634 nucleus UniProtKB:Q13526 GO:0005634 nucleus UniProtKB:Q13526 GO:0005634 nucleus UniProtKB:Q13526 GO:0005634 nucleus UniProtKB:Q13526 GO:0005654 nucleoplasm UniProtKB:Q13526 GO:0005654 nucleoplasm UniProtKB:Q13526 GO:0005654 nucleoplasm UniProtKB:Q13526 GO:0005654 nucleoplasm UniProtKB:Q13526 GO:0005654 nucleoplasm UniProtKB:Q13526 GO:0005654 nucleoplasm UniProtKB:Q13526 GO:0005737 cytoplasm UniProtKB:Q13526 GO:0005737 cytoplasm UniProtKB:Q13526 GO:0005737 cytoplasm UniProtKB:Q13526 GO:0005829 cytosol UniProtKB:Q13526 GO:0005829 cytosol UniProtKB:Q13526 GO:0005829 cytosol UniProtKB:Q13526 GO:0005829 cytosol UniProtKB:Q13526 GO:0005829 cytosol UniProtKB:Q13526 GO:0016607 nuclear speck UniProtKB:Q13526 GO:0030496 midbodyUniProtKB:Q13526 GO:0036064 ciliary basal body UniProtKB:Q13526 GO:0036064 ciliary basal body UniProtKB:Q13526 GO:0098978 glutamatergic synapse"
Organisms for which functions have been demonstratedHomo sapiens
Sequence length163.0
FASTA sequence>sp|Q13526|PIN1_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1 MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Structure Information
PDB IDNA
Quaternary structureNA
SCOP
CATH
TM Helix Predictionno TM helices
DisProt Annotation
Predicted Disorder Regions
Connections to Disease
OMIM ID
Function 1
Function descriptionenzyme, peptidyl-prolyl isomerase
References for functionChen XR, Dixit K, Yang Y, McDermott MI, Imam HT, Bankaitis VA, Igumenova TI. A novel bivalent interaction mode underlies a non-catalytic mechanism for Pin1-mediated protein kinase C regulation. Elife. 2024 Apr 30;13:e92884. doi: 10.7554/eLife.92884. PMID: 38687676; PMCID: PMC11060717.
E.C. numberEC:5.2.1.8
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbinds protein kinase C (PKC) and regulates its stability (chaperone-like activity)
References for functionChen XR, Dixit K, Yang Y, McDermott MI, Imam HT, Bankaitis VA, Igumenova TI. A novel bivalent interaction mode underlies a non-catalytic mechanism for Pin1-mediated protein kinase C regulation. Elife. 2024 Apr 30;13:e92884. doi: 10.7554/eLife.92884. PMID: 38687676; PMCID: PMC11060717.
E.C. number
Location of functional site(s)
Cellular location of functioncytoplasm
Comments