| General Information |
| MoonProt ID | 64 |
| First appeared in release | 1.0 |
| Name(s) | Glucose-6-phosphate isomerase
GPI
Phosphoglucose isomerase
Phosphohexose isomerase
Gene Name: pgi |
| UniProt ID | K1MKZ7 |
| GO terms | GO:0006094 gluconeogenesis
GO:0006096 glycolysis
GO:0004347 glucose-6-phosphate isomerase activity
GO:0016853 isomerase activity
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Lactobacillus crispatus (Gram positive bacterium) |
| Sequence length | 445 aa |
| FASTA sequence | >tr|K1MKZ7|K1MKZ7_9LACO Glucose-6-phosphate isomerase OS=Lactobacillus crispatus FB077-07 GN=pgi PE=3 SV=1
MSLIKFDSSKLTQFVHENELSEMQAMVNAANTELRDGTGAGNDFRGWLNLPVDYDKDEFARIKKAAKKIQSDSEVLICIGIGGSYLGAQAAIEFLNSNFYGKEKNGMPTVVFCGNSLSGSYLYDLIEWLGDKDFSVNVISKSGTTTEPSVAFRIFKDKLIKKYGKEEAAKRIYATTDRQKGALKTEADAEGYEEFVVPDDVGGRYSVLSAVGLLPIAASGADIDELMKGAADARADYTDTDLSKATPYQYAALRNILYRKGYTTEIVENYEPSLRMFGEWCKQLMGESEGKDQKGIYPSSANFTTDLHSLGQYIQEGLRNLFETVIRVENPRHDVKIPGDEKNLDQLNFLEGKSLNYVNDRAYEGVVLAHTDGGVPVMTVNIPDQSAHTLGYMIYFFELAIAISGYLNGINPFNQPGVEAYKRNMFGLLNKPGYENLHDDLAKRL
|
| Structure Information |
| PDB ID | closest is Staphylococcus at 61% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-2,8-10,434-445 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | glucose 6-phosphate isomerase, enzyme
D-glucose 6-phosphate <=> D-fructose 6-phosphate
Carbohydrate biosynthesis; gluconeogenesis
Carbohydrate degradation; glycolysis |
| References for function | |
| E.C. number | 5.3.1.9 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | laminin, collagen I binding (not fibronectin) |
| References for function | Kainulainen V, Loimaranta V, Pekkala A, Edelman S, Antikainen J, Kylvj R, Laaksonen M, Laakkonen L, Finne J, Korhonen TK. (2012) Glutamine synthetase and glucose-6-phosphate isomerase are adhesive moonlighting proteins of Lactobacillus crispatus released by epithelial cathelicidin LL-37. J Bacteriol. 2012 May;194(10):2509-19. doi: 10.1128/JB.06704-11. Epub 2012 Mar 2.
PMID: 22389474 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |