| General Information |
| MoonProt ID | 66 |
| First appeared in release | 1.0 |
| Name(s) | Glutamine synthetase A1
GlnA1
Glutamine synthetase
Gene Name: glnA1 |
| UniProt ID | A0A0H3LHU4 |
| GO terms | GO:0006542 glutamine biosynthetic process
GO:0006807 nitrogen compound metabolic process
GO:0009399 nitrogen fixation
GO:0000166 nucleotide binding
GO:0003824 catalytic activity
GO:0004356 glutamate-ammonia ligase activity
GO:0005524 ATP binding
GO:0016874 ligase activity
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Mycobacterium tuberculosis (mycobacterium, causes tuberculosis) |
| Sequence length | 478 aa |
| FASTA sequence | >tr|A0A0H3LHU4|A0A0H3LHU4_MYCTE Glutamine synthetase OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=glnA1 PE=3 SV=1
MTEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
|
| Structure Information |
| PDB ID | 4XYC |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.10.20.70, 3.30.590.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1--6,166-172,478 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Glutamine synthetase
ATP + L-glutamate + NH3 => ADP + phosphate + L-glutamine |
| References for function | |
| E.C. number | 6.3.1.2 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | plasminogen and fibronectin binding protein |
| References for function | Xolalpa W, Vallecillo AJ, Lara M, MendozaHernandez G, Comini M, Spallek R, Singh M, Espitia C. Identification of novel bacterial plasminogen-binding proteins in the human pathogen Mycobacterium tuberculosis. Proteomics. 2007 Sep;7(18):3332-41. PMID: 17849409 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |