| General Information |
| MoonProt ID | 67 |
| First appeared in release | 1.0 |
| Name(s) | Histone H1
Histone H1.4
H1 VAR.2
H1e
H1f4
Gene Name: Hist1h1e
|
| UniProt ID | P43274 (H14_MOUSE), Reviewed |
| GO terms | GO:0006334 nucleosome assembly
GO:0016584 nucleosome positioning
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome |
| Organisms for which functions have been demonstrated | Mus musculus (Mouse, mammal) |
| Sequence length | 219 |
| FASTA sequence | >gi|193865|gb|AAA37814.1| histone H1 [Mus musculus]
MSETAPAAPAAPAPAEKTPVKKKARKAAGGAKRKTSGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKRAGAAKAKKPAGAAKKPKKAAGTATAKKSTKKTPKKAKKPAAAAGAKKAKSPKKAKATKAKKAPKSPAKAKTVKPKAAKPKTSKPKAAKPKKTAAKKK
|
| Structure Information |
| PDB ID | none |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-37, 111-219 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Histone H1
binds to DNA near nucleosomes
aids in condensation of nucleosome chains into higher-order structured fibers |
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | thyroglobulin receptor |
| References for function | Brix K, Summa W, Lottspeich F, Herzog V. Extracellularly occurring histone H1 mediates the binding of thyroglobulin to the cell surface of mouse macrophages. J Clin Invest. 1998 Jul 15;102(2):283-93.
PMID: 9664069 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |