| General Information |
| MoonProt ID | 673 |
| First appeared in release | 4.0 |
| Name(s) | ribosomal protein b21 |
| UniProt ID | Q9KD65 |
| GO terms | "GO:0003735 structural constituent of ribosome ; GO:0006412 translation ; GO:0005840 ribosome ; GO:1990904 ribonucleoprotein complex" |
| Organisms for which functions have been demonstrated | Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans) |
| Sequence length | 57.0 |
| FASTA sequence | >sp|Q9KD65|RS21_HALH5 Small ribosomal subunit protein bS21 OS=Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=rpsU PE=3 SV=1 MAETRVRKNESIDAALRRFKRSLSKEGTLAEVRKRKHYEKPSVRRKKKSEAARKRKF |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ribosomal protein b21, protein component of the small subunit of the ribosome |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm, bound to ribosome |
| Comments | |
| Function 2 |
| Function description | component of a ribonucleoprotein complex with OLE RNA and OLE-associated proteins A, B, and C |
| References for function | Wencker FDR, Lyon SE, Breaker RR. Evidence that ribosomal protein bS21 is a component of the OLE ribonucleoprotein complex. RNA Biol. 2025 Dec;22(1):1-14. doi: 10.1080/15476286.2025.2491842. Epub 2025 May 5. PMID: 40322971; PMCID: PMC12054373. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |