Protein Information

General Information
MoonProt ID673
First appeared in release4.0
Name(s)ribosomal protein b21
UniProt IDQ9KD65
GO terms"GO:0003735 structural constituent of ribosome ; GO:0006412 translation ; GO:0005840 ribosome ; GO:1990904 ribonucleoprotein complex"
Organisms for which functions have been demonstratedHalalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans)
Sequence length57.0
FASTA sequence>sp|Q9KD65|RS21_HALH5 Small ribosomal subunit protein bS21 OS=Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=rpsU PE=3 SV=1 MAETRVRKNESIDAALRRFKRSLSKEGTLAEVRKRKHYEKPSVRRKKKSEAARKRKF
Structure Information
PDB IDNA
Quaternary structureNA
SCOP
CATH
TM Helix Predictionno TM helices
DisProt Annotation
Predicted Disorder RegionsPredicted disorder at N terminus (aa 1-8), and C terminus (aa 29-57)
Connections to Disease
OMIM ID
Function 1
Function descriptionribosomal protein b21, protein component of the small subunit of the ribosome
References for function_
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, bound to ribosome
Comments
Function 2
Function descriptioncomponent of a ribonucleoprotein complex with OLE RNA and OLE-associated proteins A, B, and C
References for functionWencker FDR, Lyon SE, Breaker RR. Evidence that ribosomal protein bS21 is a component of the OLE ribonucleoprotein complex. RNA Biol. 2025 Dec;22(1):1-14. doi: 10.1080/15476286.2025.2491842. Epub 2025 May 5. PMID: 40322971; PMCID: PMC12054373.
E.C. number
Location of functional site(s)
Cellular location of functioncytoplasm
Comments