| General Information |
| MoonProt ID | 83 |
| First appeared in release | 1.0 |
| Name(s) | Peroxiredoxin |
| UniProt ID | A0A125WDU3 |
| GO terms | GO:0055114 oxidation-reduction process
GO:0004601 peroxidase activity
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity |
| Organisms for which functions have been demonstrated | Neisseria meningitidis (Gram negative bacterium) |
| Sequence length | 122 aa |
| FASTA sequence | >tr|A0A125WDU3|A0A125WDU3_NEIME Antioxidant, AhpC/TSA family OS=Neisseria meningitidis NM2795 GN=NMEN2795_0797 PE=4 SV=1
MVMYFYPKDSTPGCTTEGLDFNARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFQFELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNGEGKMTHEWRKVKVAGHAQEVLETLSR
|
| Structure Information |
| PDB ID | closest is Xanthonomas at 67% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-6), and C terminus (aa 116-122) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Peroxiredoxin, antioxidant |
| References for function | |
| E.C. number | 1.11.1.15 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | plasminogen binding |
| References for function | Knaust A, Weber MV, Hammerschmidt S, Bergmann S, Frosch M, Kurzai O. (2007) Cytosolic proteins contribute to surface plasminogen recruitment of Neisseria meningitidis. J Bacteriol. 189(8):3246-55. PMID: 17307854 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |