General Information |
MoonProt ID | 83 |
First appeared in release | 1.0 |
Name(s) | Peroxiredoxin |
UniProt ID | A0A125WDU3 |
GO terms | GO:0055114 oxidation-reduction process
GO:0004601 peroxidase activity
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity |
Organisms for which functions have been demonstrated | Neisseria meningitidis (Gram negative bacterium) |
Sequence length | 122 aa |
FASTA sequence | >tr|A0A125WDU3|A0A125WDU3_NEIME Antioxidant, AhpC/TSA family OS=Neisseria meningitidis NM2795 GN=NMEN2795_0797 PE=4 SV=1
MVMYFYPKDSTPGCTTEGLDFNARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFQFELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNGEGKMTHEWRKVKVAGHAQEVLETLSR
|
Structure Information |
PDB ID | closest is Xanthonomas at 67% amino acid sequence identity |
Quaternary structure | |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Peroxiredoxin, antioxidant |
References for function | |
E.C. number | 1.11.1.15 |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | plasminogen binding |
References for function | Knaust A, Weber MV, Hammerschmidt S, Bergmann S, Frosch M, Kurzai O. (2007) Cytosolic proteins contribute to surface plasminogen recruitment of Neisseria meningitidis. J Bacteriol. 189(8):3246-55. PMID: 17307854 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cell surface |
Comments | |