| General Information |
| MoonProt ID | 87 |
| First appeared in release | 1.0 |
| Name(s) | Phosphoglycerate kinase
PGK1
Gene Name: PGK1 |
| UniProt ID | P46273 (PGK_CANAL), Reviewed |
| GO terms | GO:0006096 glycolysis
GO:0016310 phosphorylation
GO:0044416 induction by symbiont of host defense response
GO:0051701 interaction with host
GO:0000166 nucleotide binding
GO:0004618 phosphoglycerate kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0005576 extracellular region
GO:0005618 cell wall
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009277 fungal-type cell wall
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0030446 hyphal cell wall
|
| Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
| Sequence length | 417 |
| FASTA sequence | >gi|799385|gb|AAA66523.1| phosphoglycerate kinase [Candida albicans]
MSLSNKLSVKDLDVAGKRVFIRVDFNVPLDGKTITNNQRIVAALPTIKYVEEHKPKYIVLASHLGRPNGERNDKYSLAPVATELEKLLGQKVTFLNDCVGPEVTKAVENAKDGEIFLLENLRYHIEEEGSSKDKDGKKVKADPEAVKKFRQELTSLADVYINDAFGTAHRAHSSMVGLEVPQRAAGFLMSKELEYFAKALENPERPFLAILGGAKVSDKIQLIDNLLDKVDMLIVGGGMAFTFKKILNKMPIGDSLFDEAGAKNVEHLVEKAKKNNVELILPVDFVTADKFDKDAKTSSATDAEGIPDNWMGLDCGPKSVELFQQAVAKAKTIVWNGPPGVFEFEKFANGTKSLLDAAVKSAENGNIVIIGGGDTATVAKKYGVVEKLSHVSTGGGASLELLEGKDLPGVVALSNKN |
| Structure Information |
| PDB ID | closest is Saccharomyces at 75% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-5), middle region (aa 132-139), and C terminus (aa 411-417) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Phosphoglycerate kinase, enzyme
ADP + 1,3-bisphosphoglycerate => ATP + 3-phospho-D-glycerate
Carbohydrate degradation, glycolysis |
| References for function | |
| E.C. number | 2.7.2.3 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | plasminogen binding |
| References for function | Crowe, J.D. et al. (2003) Candida albicans binds human plasminogen:
identification of eight plasminogen-binding proteins.Mol Microbiol. 2003 Mar;47(6):1637-51.PMID: 12622818 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |