General Information |
MoonProt ID | 87 |
First appeared in release | 1.0 |
Name(s) | Phosphoglycerate kinase
PGK1
Gene Name: PGK1 |
UniProt ID | P46273 (PGK_CANAL), Reviewed |
GO terms | GO:0006096 glycolysis
GO:0016310 phosphorylation
GO:0044416 induction by symbiont of host defense response
GO:0051701 interaction with host
GO:0000166 nucleotide binding
GO:0004618 phosphoglycerate kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0005576 extracellular region
GO:0005618 cell wall
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009277 fungal-type cell wall
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0030446 hyphal cell wall
|
Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
Sequence length | 417 |
FASTA sequence | >gi|799385|gb|AAA66523.1| phosphoglycerate kinase [Candida albicans]
MSLSNKLSVKDLDVAGKRVFIRVDFNVPLDGKTITNNQRIVAALPTIKYVEEHKPKYIVLASHLGRPNGERNDKYSLAPVATELEKLLGQKVTFLNDCVGPEVTKAVENAKDGEIFLLENLRYHIEEEGSSKDKDGKKVKADPEAVKKFRQELTSLADVYINDAFGTAHRAHSSMVGLEVPQRAAGFLMSKELEYFAKALENPERPFLAILGGAKVSDKIQLIDNLLDKVDMLIVGGGMAFTFKKILNKMPIGDSLFDEAGAKNVEHLVEKAKKNNVELILPVDFVTADKFDKDAKTSSATDAEGIPDNWMGLDCGPKSVELFQQAVAKAKTIVWNGPPGVFEFEKFANGTKSLLDAAVKSAENGNIVIIGGGDTATVAKKYGVVEKLSHVSTGGGASLELLEGKDLPGVVALSNKN |
Structure Information |
PDB ID | closest is Saccharomyces at 75% amino acid sequence identity |
Quaternary structure | |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-5, 70-73, 130-139, 414-417 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Phosphoglycerate kinase, enzyme
ADP + 1,3-bisphosphoglycerate => ATP + 3-phospho-D-glycerate
Carbohydrate degradation, glycolysis |
References for function | |
E.C. number | 2.7.2.3 |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | plasminogen binding |
References for function | Crowe, J.D. et al. (2003) Candida albicans binds human plasminogen:
identification of eight plasminogen-binding proteins.Mol Microbiol. 2003 Mar;47(6):1637-51.PMID: 12622818 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cell surface |
Comments | |